KEGG   Bacillus subtilis subsp. subtilis 168: BSU08340
Entry
BSU08340          CDS       T00010                                 

Symbol
padR
Name
(RefSeq) negative transcription regulator PadR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Vir_act_alpha_C PadR CEP63 HTH_34 RTP DUF3045
Other DBs
NCBI-GeneID: 936174
NCBI-ProteinID: NP_388715
Pasteur: BG12220
BSORF: BG12220
UniProt: P94443 A0A6M3Z8Z3
Position
complement(909198..909746)
AA seq 182 aa
MRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTI
QGTKLEKKMYTLTDSGKQELHDWLIRHQPIPETVKDEFMLKAYFISCLSRQEASDLFKDQ
LQKRQAKLSDLQGSYEKLMASAEPMSFSSPDFGHYLVLTKALEREKNYVSWLESILAMID
KD
NT seq 549 nt   +upstreamnt  +downstreamnt
atgagagtattaaaatacgccatattagggcttttgcgaaaaggcgaattgagtggatac
gatattacgagttattttaaagaggagctcggccagttttggagcgccaagcacagccag
atttaccctgagctcaaaaagctgacggatgaaggatttatcacgttccggacaacgatt
cagggcacaaagctggagaaaaagatgtacaccctgacagacagcggaaagcaggagctg
catgactggctgatccgccaccagccgatacccgagacggtgaaggatgaatttatgctg
aaggcttatttcatttcttgtctatcgcgccaggaggcttctgatttgttcaaagaccag
ctgcaaaaacgccaggccaagctttctgacttacagggaagctatgaaaagcttatggct
tcagcagagccgatgtcattttcttcaccggacttcggccactatcttgtgctaacgaaa
gcgctggagcgggagaaaaattacgtttcttggctggaatcaattttagctatgatagat
aaggattaa

DBGET integrated database retrieval system