KEGG   Bacillus subtilis subsp. subtilis 168: BSU08350
Entry
BSU08350          CDS       T00010                                 

Symbol
estB
Name
(RefSeq) extracellular esterase EstB
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU08350 (estB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     BSU08350 (estB)
SSDB
Motif
Pfam: Lipase_2 Abhydrolase_1 LCAT DUF676 Abhydrolase_6 DUF915 Palm_thioest Hydrolase_4 DUF900 Ser_hydrolase PGAP1
Other DBs
NCBI-GeneID: 939715
NCBI-ProteinID: NP_388716
Pasteur: BG11951
BSORF: BG11951
UniProt: Q79F14 A0A6M3ZDW1
Position
910019..910651
AA seq 210 aa
MKKVLMAFIICLSLILSVLAAPPSGAKAESVHNPVVLVHGISGASYNFFAIKNYLISQGW
QSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKVDIVAHSMGGANTLYYIKYLG
GGNKIQNVVTLGGANGLVSSTALPGTDPNQKILYTSIYSLNDQIVINSLSRLQGARNIQL
YGIGHIGLLSNSQVNGYIKEGLNGGGLNTN
NT seq 633 nt   +upstreamnt  +downstreamnt
gtgaaaaaagtacttatggcattcattatttgtttatcgctgattctatctgttttagcc
gctccgccgtctggcgcaaaagctgagtcagtacataatcctgtcgttcttgttcatgga
ataagtggtgcatcatacaactttttcgctattaaaaactacttaatttctcaaggctgg
caaagcaacaaactgtacgcaattgatttttatgataaaacaggaaacaacctaaataac
ggcccgcagcttgcttcatatgttgaccgtgttttaaaagagactggggcaaaaaaagta
gatattgtggctcatagtatgggaggcgccaatacgctgtactatattaaatatttaggc
gggggcaataagattcaaaatgtcgtaacgcttggaggggctaatggtttagtgtcatca
accgcgctgccgggcacagaccctaatcaaaagatcctctatacatctatttacagtctc
aatgatcaaattgtcatcaatagcttgtctcggttacaaggagcgcgaaacatccagctt
tatggcatcggtcatattggcttgctttctaatagccaagtgaacggctatatcaaagaa
gggctgaatggcggaggcctcaatacaaattaa

DBGET integrated database retrieval system