KEGG   Bacillus subtilis subsp. subtilis 168: BSU08360
Entry
BSU08360          CDS       T00010                                 

Symbol
yfiQ
Name
(RefSeq) membrane-bound acyltransferase YfiQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-GeneID: 936185
NCBI-ProteinID: NP_388717
Pasteur: BG12893
BSORF: BG12893
UniProt: O31559 A0A6M4JHJ3
Position
910840..911928
AA seq 362 aa
MQIKEIFMIRCISCLSVVLLHIISMVLMLQAEALADISHTVDSFRTLLMFSTPAFIFISE
FLLARSYPDGVPDGFLKKRGKVIFVPFLFIAAIDALLMTSAMGGEVTFLAFVQKYLANVF
LGNFIGYFILVIFQFYMLHMMFHEYLKKASPKWVLSISFVVTAAYLGYFSAASPAPASEE
GGAFPFFWVPFAGWLFYFCLAYYCGKEYKRFLALLNQYRWVVYGAAIASGALVVTVSYVG
EIGMISSKRPDIMLYSTSMIFLCFHLFSKMKHVPKIMMFISNYSFSIYLLHAYFMIIGYV
LLLNMPEIPAVPAVLLLFAVCTAGPIMTSWALNKFKYGYLFVGKIYQPKQKKVTVEVRDH
AG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcaaattaaagaaatttttatgatccgctgcatttcgtgcttaagtgtcgtcttgctc
catatcatttcaatggtcctgatgcttcaggcagaagctcttgcagatatttctcacact
gttgattctttccgcacactcctgatgttcagcacgcccgcttttattttcatctctgaa
tttttactggcccgttcttatcctgatggggtgcctgacggttttttaaagaagcgggga
aaagtgatttttgttccttttttatttatcgcagccatcgatgcgctgctgatgaccagt
gcgatggggggagaggtaacctttctcgcgtttgtgcaaaaatatctggcgaacgtattc
ttaggaaactttatcggatacttcattctcgtcatctttcaattttacatgctgcatatg
atgtttcatgagtatttgaaaaaagcatcgccgaaatgggtgctgtctatctcatttgtg
gtgacagccgcttatttaggctatttctccgcagccagcccggctcctgcttctgaagag
ggaggggcatttccgttcttctgggttccgttcgcaggctggcttttctacttttgtcta
gcctactattgcggaaaagaatacaagcgttttttagcgctgctgaaccaataccgctgg
gtggtgtacggcgccgcaattgcttctggggcgctggttgtcactgtttcttatgtcggt
gaaatcggcatgatcagctcgaagcggcctgatatcatgctgtattcaacaagcatgatt
ttcctgtgttttcatttgttttccaaaatgaagcatgtgccgaaaatcatgatgtttatc
agcaactattccttttcgatttatctgcttcatgcctattttatgattataggctacgtg
ttgcttttgaatatgcccgaaattcctgccgtaccggctgttctcctgttgtttgccgtg
tgcacagccggcccgattatgacctcatgggcgctgaataagttcaaatacgggtattta
tttgtggggaaaatttatcagccaaaacagaagaaggtaacagtcgaagtgcgtgatcac
gcagggtga

DBGET integrated database retrieval system