KEGG   Bacillus subtilis subsp. subtilis 168: BSU08380
Entry
BSU08380          CDS       T00010                                 

Symbol
yfiS
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_3
Other DBs
NCBI-GeneID: 939219
NCBI-ProteinID: NP_388719
Pasteur: BG12895
BSORF: BG12895
UniProt: O31561 A0A6M3Z8P3
Position
complement(912547..913800)
AA seq 417 aa
MEKPLFRNQKGLMTLLASQTISSLGDWLHILAVLTLAAFQLHASPLDMSLLMMSFALPVI
VLGPVSGLLADRFDRKTIMFLSEIGRALTVISCVYVSELWQLYVLLSVQSCFSSLFLPAK
NGKLKELAPEAHIQQAVSVSSIIDNSSKIFGPALGGTLIAAFSIHSVFYINAGAFFLSAV
ILFFLPRDAFLQKANTPQEKTAALTSIKEGLQFLKRMPLLLTGLLTACVVLFVLQIGDSQ
AIILIRSFSGAPPELAGWCMAVSGAGMLLTAAITGRRRITSYLLYFSAGTLLLGLATGGA
PFLSGMGIAGITLFIFAFFIMGAAFGLVHIPFQILVQTTVPVDYSGRVFGAIQSATTLAS
ILGMAGGGVLAEWIGVSLAFLVCGCLLIMIGLITLIGKKIAESRRYLVTKSNKGAQG
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggaaaaaccgttgtttcgcaatcaaaaaggactgatgacactgttagcctcgcaaacc
atttcttcacttggagactggcttcacattttggccgtgctaacattagccgcttttcag
cttcatgcttctccattagatatgtcgcttttaatgatgtcgtttgctttgcctgtcatt
gtactcggacctgtatcgggtctgcttgccgaccgttttgacagaaaaacgatcatgttt
ctatctgaaatcggccgtgccctcactgttatcagctgcgtttatgtcagtgagctttgg
cagctttacgtattgctatccgttcagagctgtttttcttcactttttttacctgctaaa
aacggaaagcttaaggaattggctccggaagcacacattcagcaggccgtttccgtcagc
agcatcattgataacagctcaaaaatcttcggccctgcccttggcggcacgctgatcgct
gctttctcgatacactctgttttttatataaacgccggcgccttctttctttccgctgtc
attttgtttttccttcccagagatgcttttttacaaaaagccaatacacctcaagaaaaa
acagcagcacttacttctatcaaggaaggccttcagtttttgaaacggatgccgcttcta
ttaacaggcttactaacagcttgtgtcgttctctttgttttgcagattggtgattcccaa
gcgattattcttatccgctccttttcaggagctccgcccgagctggcaggctggtgcatg
gccgtaagcggagccgggatgctccttacagcggccattaccggcagacggcgaatcact
tcttatttgctttatttctcagctggaacccttcttcttggactagcaactggaggtgcg
ccattcctaagcggtatgggaattgccggcatcactctctttatatttgcttttttcatc
atgggggcggctttcggcctcgtccatattccatttcagattctcgtgcaaacaacagtg
cctgtcgattacagcggtagggtgttcggcgctattcagagtgcgacaaccctcgcctct
atcctcggcatggcgggcgggggcgtgctggcggaatggatcggtgtatcacttgctttt
cttgtctgtggctgcttgctgatcatgattgggttgattacacttataggtaagaaaatt
gcagaaagcaggcgatatcttgtcaccaaaagtaacaaaggagcacaaggataa

DBGET integrated database retrieval system