KEGG   Bacillus subtilis subsp. subtilis 168: BSU08390
Entry
BSU08390          CDS       T00010                                 

Symbol
yfiT
Name
(RefSeq) metal-dependent hydrolase YfiT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DinB_2 MDMPI_N DinB DUF664
Other DBs
NCBI-GeneID: 939711
NCBI-ProteinID: NP_388720
Pasteur: BG12896
BSORF: BG12896
UniProt: O31562 A0A6M4JJQ4
Structure
Position
913924..914460
AA seq 178 aa
MTSVNLSYPIGEYKPRESISKEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWT
VRQVVHHLADSHMNSYIRFKLSLTEETPAIRPYDEKAWSELKDSKTADPSGSLALLQELH
GRWTALLRTLTDQQFKRGFYHPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGWS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgacatcagtcaatctaagctacccaataggagaatacaagccgagggaatccatatcg
aaggagcaaaaagataaatggattcaagtacttgaagaagtgccggcaaaattgaagcaa
gctgtagaggtcatgacggacagccagcttgacacaccgtaccgggacggtggatggacc
gttcggcaagttgttcatcatctggctgacagtcatatgaacagctatattcgttttaaa
ttgagcttgacggaagagacaccggctatccgtccgtatgatgaaaaagcatggtcggag
ctaaaagactcgaaaacggcagatccgagcggctcactcgcgcttttgcaggagcttcac
ggaagatggacggctctgctccgcaccctgacggatcagcaatttaagcgcggattttat
caccctgatacaaaggagatcattaccctggagaacgcgctcggcctgtatgtctggcac
tcacatcaccatatcgctcatattacggagctttccagacggatggggtggtcttaa

DBGET integrated database retrieval system