KEGG   Bacillus subtilis subsp. subtilis 168: BSU08400
Entry
BSU08400          CDS       T00010                                 

Symbol
yfiU
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12 OATP MFS_1_like
Other DBs
NCBI-GeneID: 936182
NCBI-ProteinID: NP_388721
Pasteur: BG12897
BSORF: BG12897
UniProt: O31563 A0A6M3Z8P0
Position
complement(914457..916013)
AA seq 518 aa
MSEALTEQKSQKWAISLFTIGVFMAALDNGIISAALTTINESFSVSPSWGSWGITLYTLG
LSVSVPIVGKLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALGGGGIFI
IGSSHILATLPKEKQGKALGLLGAMNGMAAVLGPNIGSFLLDWTGSWHWLFLINLPIAVL
LVVFGACFIAETKAPEAKRLDAAGIFLLSLSILAVMYGMTNLDGANLLHSLGNPEVYGCI
IFGILCFAALISYEKRVEMRGGDPILAYSLLRNHMFQRTLIIGLLSGGLLAAVIFIPSYV
EQYLGVPAAKAGYWMTPLALASGIGAWLGGALTDKKGPVKTVILSGIISCAGFALFPLWV
TEKWEFVIASVAAGIGFGFLLGAPLNVLVSEAAKTNKGTALGTLSLVRQIGLTLAPTLYA
GFITAGFDQIGDEINSRLSDSGYSEKAMQMIPEIDSSEVSSLQEQIERIPVPEVKTAISD
AIHASVASGYDHLYAAAAVVSLLVIAAISIPAFRRQKR
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtctgaagcattaacagagcagaaaagccaaaagtgggcaatcagcctgtttacgatt
ggcgtgtttatggctgctttagataacggaattatttcggctgctttaacaacgataaac
gagtcgttttccgtttccccttcctggggatcatggggcattaccctttatacgctcggt
cttagcgtcagtgtgccaatcgtcggaaaactttccgaccgctacggcagaaaaaaactc
tttctcattgaggtttgcctgttcggacttggttctttgcttgttgctttgagccaaagc
ttcccgctctttctgatatcgcggctgattcaggcgcttggaggcggcgggattttcatc
atcggcagctctcacattctcgcgacccttccaaaggaaaaacaggggaaggcgcttggg
ctgcttggcgcaatgaacgggatggccgctgtgctcgggccaaatatcggaagctttctg
cttgattggaccgggtcttggcattggctatttttgattaatttgccgattgccgtgcta
ttggttgttttcggcgcatgttttatcgcggaaacaaaagcacctgaggctaagcgcctc
gatgcggccggaatcttccttttgtccctgtcgattttagctgtgatgtacggcatgacc
aatcttgacggggcaaatctcttacacagcttggggaatccggaggtttatggatgtatt
atttttggcatactctgttttgcagcgcttatctcgtatgaaaagagagttgaaatgcga
ggaggcgatcccattttggcgtattctctgctgcgaaaccatatgtttcagcgcacgctt
atcatcggtttgttatccggggggctcttggcggcagtcatttttatcccgtcatatgtc
gaacagtatttgggtgtccctgccgcaaaagcaggctattggatgacaccgcttgcgttg
gcttccggaatcggcgcttggcttggcggagcacttaccgacaaaaaaggtcctgtaaaa
accgttattctttcgggaatcatctcatgtgcggggtttgctttatttccgctctgggtc
acggaaaaatgggagtttgtgatcgcaagtgtggcagctgggatcggttttggctttctg
ttaggcgctccgctgaacgtccttgtatcagaagcggcaaaaacaaataagggtacagct
cttggcacgctttcattagtaaggcaaattggactgaccttggcgcctactctttatgca
ggttttatcacagccgggtttgaccaaataggtgatgagatcaacagccgcttatcggac
agcggatattcagaaaaggcgatgcagatgattccggagatcgacagttctgaagtttct
tctttacaagaacaaatcgaacgcattcccgttcctgaagtcaaaaccgcgataagcgac
gccattcatgcgagtgtcgccagcggctatgatcatttatatgcagcggctgctgtggtc
tcacttctggtgattgctgctatcagtattccggctttccgccggcaaaagcgttaa

DBGET integrated database retrieval system