KEGG   Bacillus subtilis subsp. subtilis 168: BSU08410
Entry
BSU08410          CDS       T00010                                 

Symbol
yfiV
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB HTH_IclR HTH_24 HTH_34 HTH_5 Fe_dep_repress TFIIE_alpha Dimerisation2 HTH_22 HTH_DeoR DUF4423 Cullin Penicillinase_R FaeA HxlR Rrf2 HTH_47 HTH_PafC Replic_Relax
Other DBs
NCBI-GeneID: 939218
NCBI-ProteinID: NP_388722
Pasteur: BG12898
BSORF: BG12898
UniProt: O31564 A0A6M4JE80
Position
complement(916124..916606)
AA seq 160 aa
MEYNLHDTTVLNENILSSEEREIWVLYMKVLTSAGLGDVSEWMKLDMSMPQMKVLMLLNN
HGTLKVSDIAEKMGASLSNTTGLLDRLEKSGFVKRSHSEEDRRSVVVQLTENAKKIFRGL
YEKGHLKLKRSLELLSPEEKQAVYEGLSILSRALENAKKE
NT seq 483 nt   +upstreamnt  +downstreamnt
atggaatataatttacacgatacaacagtcttaaacgaaaacattctttcatcggaggaa
cgggaaatatgggtgctctatatgaaagtcttaacgtccgccgggctcggtgatgtgtcc
gagtggatgaaactggatatgagcatgccgcaaatgaaggtgctgatgctattaaacaac
catggaacattgaaagtgagcgacattgctgaaaaaatgggggcttccctgtccaataca
actgggctgcttgaccggcttgaaaaatcaggatttgtcaaacgctcacattctgaagag
gaccgccgctctgtagttgttcagttgacagagaatgcgaaaaagattttccggggtttg
tatgaaaagggccacctgaaattgaagcgttcattagagctgctgtcccctgaagaaaag
caggctgtttacgaagggctgtctatcctttcaagagcattagagaatgcgaaaaaagaa
taa

DBGET integrated database retrieval system