KEGG   Bacillus subtilis subsp. subtilis 168: BSU08425
Entry
BSU08425          CDS       T00010                                 

Symbol
mprF
Name
(RefSeq) phosphatidylglycerol lysyltransferase
  KO
K14205  phosphatidylglycerol lysyltransferase [EC:2.3.2.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU08425 (mprF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU08425 (mprF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU08425 (mprF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.3  lysyltransferase
     BSU08425 (mprF)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    BSU08425 (mprF)
SSDB
Motif
Pfam: LPG_synthase_C LPG_synthase_TM
Other DBs
NCBI-GeneID: 8303094
NCBI-ProteinID: YP_003097695
UniProt: C0H3X7 A0A6M4JG44
Position
916778..919348
AA seq 856 aa
MLIKKNALSILKIVFPIAVLLFVIYQSKKELTNLSFKRTLMVINGLERTDLFMLVLIGLL
AVAAMSLYDYVLKYSLRLSITNGKVFRVSWIANSFNNVLGFGGLAGVGLRMMFYKEHTKD
HKALVKGIAWLTSSMLLGLSVFSIFVAARVLPVDEVIHEKPWLWAVVIGFALILPLSLAV
SKIKDRKAGDEENADKVKNPIFAYIGASVVEWLMAGTVIYFALFAMGIHADIRYVFGVFV
IAAIGGMISLVPGGFGSFDLLFLLGMEQLGYHQEAIVTSIVLYRLAYSFIPFILGLFFAA
GDLTENTMKRLETNPRIAPAIETTNVLLVVQRAVLVRILQGSLSLIVFVAGLIVLASVSL
PIDRLTVIPHIPRPALLLFNGLSLSSALILLILPIELYKRTKRSYTMAITALVGGFVFSF
LKGLNISAIFVLPMIIVLLVLLKKQFVREQASYTLGQLIFAVALFTVALFNYNLIAGFIW
DRMKKVLRHEYFVHSTSHITHATIMAIIIVPLFFLIFTVVYHKRTKPIGEKADPERLAAF
LNEKGGNALSHLGFLGDKRFYFSSDGNALLLFGKIARRLVVLGDPSGQRESFPLVLEEFL
NEAHQKGFSVLFYQIEREDMALYHDFGYNFFKLGEEAYVDLNTFTLTGKKKAGLRAINNR
FEREEYTFHVDHPPFSDAFLEELKQISDEWLGSKKEKGFSLGFFDPSYLQKAPIAYMKNA
EGEIVAFANVMPMYQEGEISVDLMRYRGDAPNGIMDALFIRMFLWAKEEGCTSFNMGMAP
LANVGTAFTSFWSERFAAVIFNNVRYMYSFSGLRAFKEKYKPEWRGKYLAYRKNRSLSVT
MFLVTRLIGKSKKDSV
NT seq 2571 nt   +upstreamnt  +downstreamnt
ttgctgattaaaaagaatgctttatcaatattaaaaatcgtttttcctattgctgttttg
ctatttgttatttatcaatcgaaaaaagaactgacaaatctgtcattcaaacgtacgctc
atggtcatcaacggactggaacgaacggatttattcatgcttgtgttgatcggcttgctg
gctgttgcggctatgtcgctgtatgattacgtcctgaagtactcactgcgcctatcgatc
acaaacggaaaagttttcagggtttcctggatcgccaattcatttaataatgtgttggga
ttcggcggtttagccggagtcgggttaagaatgatgttctataaggagcatacgaaagac
cataaggcactcgtgaaaggaatcgcctggctcacatcatctatgctgctcggattatct
gttttcagcattttcgttgctgcgagagtgctgccagttgatgaagtgattcatgagaag
ccttggctgtgggcggtcgttatcggttttgcactgatattgccgttatctttagcggtg
tccaaaataaaagaccgcaaagctggggacgaagagaatgcggataaagtgaaaaatccg
attttcgcatatattggagcttcagttgttgaatggctcatggccgggaccgtcatctat
tttgctttgttcgctatgggcattcatgcagatatcaggtatgtgttcggggtgttcgtc
attgcggcgatcggaggaatgatcagcctcgtgccgggcggcttcggctcgtttgacctt
ttatttttgctggggatggagcagcttggctatcatcaagaggccatcgttacttctatt
gtgttgtacaggctcgcctactcatttatcccatttatcttgggactgttctttgccgcc
ggcgacctgacggaaaatacaatgaagcggctcgaaacgaacccgcgcatcgcaccggca
attgagacgacaaacgttctgcttgttgttcagcgtgcggtattagtgagaattttgcaa
ggctcgctttcccttattgtgttcgtagcaggtctgattgtcttggcctcagtttccttg
ccgattgacaggctgacggttataccgcacattccgcgcccggcgcttttgctgttcaac
ggcctgtccttaagctcagcgctcattctgctcattttgccgatcgagctttataaacgg
acaaaacgttcctacacgatggccattacagcgcttgtcggcggctttgtgttcagcttt
ttaaaagggcttaacatcagcgcgatattcgtactgccgatgattatcgtattgcttgtg
ctattgaaaaaacaatttgtccgcgaacaggcatcctatacactgggacaattgatattc
gctgtggcgctgtttactgtggcgctctttaactacaatctgatcgcgggctttatttgg
gaccggatgaagaaggtgctgcgtcacgaatatttcgtccacagcacctcgcatattaca
catgcaaccatcatggcgatcatcattgtgccgctgttcttcttgatatttacagtggtc
tatcataagagaacgaaaccgatcggagagaaagctgaccctgagcgtcttgctgcgttt
ctcaatgaaaaaggcggcaacgcgctgagccatcttggttttcttggagataagcggttt
tatttttctagcgatggaaatgcactgcttctgtttgggaaaatcgccagaaggctggtc
gtgctcggcgatccatctggccaaagagaatcattcccgctcgtgctggaagaatttctg
aacgaagcgcatcagaagggattcagtgttttgttctatcaaattgaacgagaggacatg
gcgctgtatcacgattttggctacaacttctttaaattgggtgaggaagcatatgtagat
ttaaatacatttaccttgactgggaagaaaaaagccggccttcgggcaatcaataaccgc
tttgagcgggaggagtatactttccatgtggatcatcccccattttctgatgcgtttttg
gaggagctgaagcaaatctcagacgaatggctcggctcgaaaaaagagaagggattctcg
ctcggattttttgatccttcctatttacagaaagcgccgatcgcctatatgaaaaatgca
gaaggagagatcgttgcattcgcaaatgtcatgccgatgtaccaggaaggagagatatcg
gtcgatctgatgcgctatcgcggcgacgctccaaatggcattatggacgcattgtttatc
cgtatgtttttatgggcaaaggaagagggctgtacgtcatttaatatggggatggcaccc
ttggccaatgtcggcactgcctttacatccttctggtccgaaaggtttgccgctgtcatt
tttaataatgtcagatacatgtacagtttcagcggcctaagagcctttaaagaaaaatat
aaaccggagtggcgagggaaatacttagcgtatcggaaaaacagatctctttctgtcacc
atgttcctcgttacacgtctgattggcaaaagcaaaaaagactccgtctaa

DBGET integrated database retrieval system