KEGG   Bacillus subtilis subsp. subtilis 168: BSU08440
Entry
BSU08440          CDS       T00010                                 

Symbol
yfiY
Name
(RefSeq) siderophore-binding lipoprotein YfiY
  KO
K25109  iron-siderophore transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08440 (yfiY)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron-siderophore transporter
    BSU08440 (yfiY)
SSDB
Motif
Pfam: Peripla_BP_2 Oxidored_nitro
Other DBs
NCBI-GeneID: 939206
NCBI-ProteinID: NP_388725
Pasteur: BG12901
BSORF: BG12901
UniProt: O31567 A0A6M4JGP0
Position
complement(919366..920343)
AA seq 325 aa
MKKHISMLFVFLMAVMVLSACNSSESSSNSEVSSSKTRTVKHAMGTSDNIPANPKRIVVL
TNEGTEALLALGIKPVGAVKSWKGDPWYDYLKDDMKGVKNVGLETEPNVEAIAELKPDLI
IGNKVRQEKIYDQLNAIAPTVFAESLAGNWKDNLTLYANAVNKADKGKEVIADFDKRVSD
LKNKLGDQTNKTVSVVRFLSGESRIYYTDSFPGIILDQLGFKRPEKQVELFKKQKDQFTF
STDSKESIPDMDADVLFYFTYKADNAKENEKWANQWTSSSLWKNLKAVKSGNAHEVDDVV
WTTAGGIKAANYLLDDIETYFLKTK
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaaaagcatatcagcatgctattcgtatttttaatggccgttatggtactttctgcc
tgtaatagttcagaaagttcaagcaacagcgaggtgtcaagcagcaaaacaagaacggtc
aaacatgcaatggggacatcagacaacatccccgccaatccaaaacggattgttgtttta
actaatgaaggaacagaggcgctcttagcgcttggcattaagccggtcggagccgtaaag
tcatggaagggcgacccgtggtatgactatctgaaagatgacatgaaaggtgttaaaaac
gtcggtcttgaaacggaaccgaatgtggaagccatcgcagaattaaagcctgatttgatt
attggaaacaaagtgcgccaggaaaaaatttatgatcagttaaatgcgattgcgccgact
gtttttgctgaatctttggccgggaactggaaggataacctgactctatacgccaacgcg
gtgaataaggcggacaaaggcaaggaagtcattgccgattttgataaacgtgtttctgat
ttaaaaaacaagctgggcgaccagacaaacaaaaccgtttcagtcgtacgctttttatcc
ggtgaatcaagaatctattataccgattcatttcctgggattattttagaccagcttggc
ttcaaacgccctgaaaaacaagtggaactgtttaagaaacaaaaggaccaatttacgttc
tcaaccgacagtaaagaatctattcctgatatggatgctgatgtgctgttttatttcact
tataaagccgataatgcaaaagaaaatgaaaaatgggccaatcagtggacaagcagttca
ctatggaaaaacctgaaggccgtgaagtcaggtaatgcacatgaagtcgatgacgtcgta
tggacaaccgcaggcggaattaaagccgcaaactacctgcttgatgatattgaaacctac
ttcttaaaaacgaaataa

DBGET integrated database retrieval system