KEGG   Bacillus subtilis subsp. subtilis 168: BSU08450
Entry
BSU08450          CDS       T00010                                 

Symbol
yfiZ
Name
(RefSeq) siderophore transport system permease protein YfiZ
  KO
K25110  iron-siderophore transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08450 (yfiZ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron-siderophore transporter
    BSU08450 (yfiZ)
SSDB
Motif
Pfam: FecCD
Other DBs
NCBI-GeneID: 936179
NCBI-ProteinID: NP_388726
Pasteur: BG12902
BSORF: BG12902
UniProt: O31568 A0A6M3Z902
Position
920474..921475
AA seq 333 aa
MICKKASSKWIVLVCLIFILLTAVCASVVYGYTGTSWRQVYQAFTSFNGTNEHVIIKDVR
LPRALVATVVGASLAAAGALMQALTKNPLASPGIFGINAGAGFFIVAGSFFLHIQSPQAL
VWSSFLGAAFTAAIVYAAGSLGREGLTPIKLTLAGAAMAAMFSSLTQGLLSVNELELAQV
LFWLTGSVQGRSLDLLMTMFPYAAAALVICFFLGQKINLLVMGEDVAKGLGQKTGLLKFV
MALCVVMLAGSAVAIAGPISFIGIIIPHFARFVVGNDYRWVLPFSAVLGAILLVCADIGA
RYIIMPQEVPVGVMTAIIGMPVFVYIARRGAKL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgatctgcaaaaaggcatcttcaaaatggattgtgttagtatgtctgattttcatttta
ctgacggctgtctgcgcaagcgtcgtgtatggctatacaggtacgtcatggagacaggtc
tatcaggcgtttacttccttcaatggaacaaatgagcatgtcatcatcaaggatgtcagg
cttccgcgcgctttggttgcgacagtcgtcggcgcctcgcttgcagccgcgggcgctctc
atgcaggcgctcacaaaaaatccgcttgcgtcaccggggattttcgggattaacgccggt
gcaggtttttttattgttgccggatcgttttttctgcatattcagtcacctcaggcatta
gtatggagctcgtttctgggggcagcatttaccgctgcgatcgtctatgcagcaggctcg
cttgggagggaagggctgacgccaatcaaactgacgctggcgggagctgccatggcagcc
atgttttcttctctgacacagggcttgctgtctgtcaacgaactcgagcttgcccaggtg
cttttttggctgactggctctgtgcagggccggagtctggatctgttgatgacgatgttt
ccatatgcagcggcagcgctggtaatctgcttctttctcggccaaaaaattaatctcctc
gttatgggagaagatgtggcaaaaggactcggccaaaaaacaggcctgctgaaatttgtg
atggcgctttgtgttgtcatgcttgcagggtccgctgtcgccattgccgggccgatttct
tttatcggcatcattattccgcattttgcccgctttgtcgttggtaatgattatcgctgg
gttctgccattttccgctgttttgggtgccattttgcttgtttgcgcggatatcggtgcg
cgatatatcattatgcctcaggaagttcctgtcggggtcatgaccgccatcatcggaatg
cctgtgtttgtgtacatcgcaagaaggggggcgaagctatga

DBGET integrated database retrieval system