KEGG   Bacillus subtilis subsp. subtilis 168: BSU08480
Entry
BSU08480          CDS       T00010                                 

Symbol
yfhC
Name
(RefSeq) NAD(P)H nitroreductase YfhC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-GeneID: 939221
NCBI-ProteinID: NP_388729
Pasteur: BG12878
BSORF: BG12878
UniProt: O31571 A0A6M4JEG2
Position
923587..924171
AA seq 194 aa
MPQTEQIHQHSVLRDIIRSRRSIRKFKQEPVPSAVILDMLETAKYAPNHRVTEPWRFIYV
SSETGKANLINTFAAFSKKSKPDMTEEKLQNFKNTLGRVPGFLLVVFQEDENERARDDDF
AATSSLIQNLQLLAWEKGIGMVWKSGKILYDKEVHQAFGLQDNERFAAIIQTGYPDEAPE
VKKRTPIRDRFTEM
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcctcaaaccgaacaaatacatcagcattcagtactgagggacatcatacgcagcaga
agatcgattcgaaagtttaaacaagagccagtaccttcagcagtcattcttgacatgctt
gaaacggcaaaatatgcgccaaatcacagagtgacagagccatggagatttatttacgtt
tccagtgagacaggtaaagcgaacctcattaatacatttgcagcgttctctaagaaatcc
aagccggatatgacagaggaaaagcttcaaaatttcaaaaacacacttgggcgcgttccg
ggatttctcctcgtcgtgtttcaggaagatgaaaacgaaagagcgcgggacgacgatttt
gcggcaacaagctcgttgattcaaaatcttcagcttctcgcttgggaaaaaggaatcggc
atggtttggaaaagcggaaaaatcctttatgacaaagaagtccatcaggcctttggttta
caggataatgagcgtttcgccgccatcatacaaacaggttatcctgacgaggcgccggaa
gtgaaaaaacgcacaccgatccgcgaccgattcactgaaatgtaa

DBGET integrated database retrieval system