KEGG   Bacillus subtilis subsp. subtilis 168: BSU08490
Entry
BSU08490          CDS       T00010                                 

Symbol
yfhD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfhD FAM177
Other DBs
NCBI-GeneID: 939709
NCBI-ProteinID: NP_388730
Pasteur: BG12879
BSORF: BG12879
UniProt: O31572 A0A6M3Z8Q2
Position
complement(924210..924401)
AA seq 63 aa
MGRNHIHKNRDKNKQKLPQVPDALKRETDGVYEEYSTELADADDREAQERAKAADNRAKK
KSR
NT seq 192 nt   +upstreamnt  +downstreamnt
atgggcagaaatcatatccacaaaaaccgtgataaaaacaaacaaaagcttccacaagtt
cccgatgccttaaaaagggaaactgacggcgtttacgaagaatattcaaccgagcttgct
gatgcagatgaccgcgaagcgcaagagcgtgcgaaagcagccgacaacagagcgaaaaag
aaatctcgttaa

DBGET integrated database retrieval system