KEGG   Bacillus subtilis subsp. subtilis 168: BSU08500
Entry
BSU08500          CDS       T00010                                 

Symbol
yfhE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfhE
Other DBs
NCBI-GeneID: 936184
NCBI-ProteinID: NP_388731
Pasteur: BG12880
BSORF: BG12880
UniProt: O31573 A0A6M4JJR4
Position
complement(924468..924578)
AA seq 36 aa
MEKKREKHQQGANLKKMQEVLYSGEFKKAEKAAKRK
NT seq 111 nt   +upstreamnt  +downstreamnt
atggaaaaaaagagggagaagcaccagcaaggcgccaacctgaaaaaaatgcaggaagtt
ctttattcaggcgaatttaaaaaagcggaaaaagctgctaagcggaagtag

DBGET integrated database retrieval system