KEGG   Bacillus subtilis subsp. subtilis 168: BSU08510
Entry
BSU08510          CDS       T00010                                 

Symbol
yfhF
Name
(RefSeq) epimerase family protein YfhF
  KO
K07071  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU08510 (yfhF)
SSDB
Motif
Pfam: Epimerase DUF1731 GDP_Man_Dehyd NmrA NAD_binding_4 KR RmlD_sub_bind NAD_binding_10 DUF2184 DUF4283 3Beta_HSD
Other DBs
NCBI-GeneID: 939217
NCBI-ProteinID: NP_388732
Pasteur: BG12881
BSORF: BG12881
UniProt: O31574 A0A6M3Z8Q0
Position
complement(924633..925544)
AA seq 303 aa
MNIAMTGGTGFLGQHLTGVLTRQGHHVYILSRNARETEQKNMTYVQWLSEGAAPEQELPH
IDVWINLAGKSIFGRWTEKTKQHILSSRINATREVQRLIQKQKEKPKTLIQASAVGIYGT
SLEKTFTEDSATSDEDFLSHTAHLWEKEGQHIEAMGIRTVYARFGVMLGEKGALPLMILP
YKFLAGGTIGTGRQWLSWIHVEDAAQMIRYAVENAGISGPMNVTAPNPVDMKQFGKTIAR
VKHRPHWLPVPEFFLSKALGEMSLLIVKGQRALPKKAITSGFRFTYSDLEFALSQLIADR
KTV
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaatatcgcaatgacgggcggaaccggttttctcggccagcatctgacaggcgttctt
acccgccagggacaccatgtttatattttatcaagaaacgcaagggaaactgaacaaaaa
aatatgacatatgtccaatggctgtcggaaggagccgcaccggagcaggaacttcctcat
attgatgtctggataaatcttgcgggaaaatcgatttttggccgctggacagaaaaaacg
aagcagcacattctctccagccgtatcaatgcgacgcgtgaagtgcagcggcttattcag
aaacagaaggagaagccgaagacattgatccaagccagtgccgtgggcatttacggcaca
agccttgagaaaactttcacagaggattctgcaacgtcagatgaggattttctcagccat
actgcacacctgtgggaaaaggaaggacagcatattgaagcgatgggcatccggacagtt
tatgcgagatttggcgtgatgcttggagaaaaaggcgctctcccgctcatgattctcccc
tataagtttctggccggcggaacgatcggaacgggaaggcagtggctgtcatggattcat
gtcgaggatgcggcccagatgatccgatatgcggtggaaaacgccggcatctcaggccca
atgaatgtcaccgcgcccaatcctgtggacatgaagcaattcggaaaaacgattgcacgg
gtgaagcaccgcccgcactggctccccgtcccggaattctttttatcaaaagcattgggt
gaaatgagtcttttgattgtgaaaggacagcgcgctcttccgaaaaaagcgataacctct
ggatttcgttttacatattcggatcttgaatttgcactctcacagctgatagcggaccga
aagactgtataa

DBGET integrated database retrieval system