KEGG   Bacillus subtilis subsp. subtilis 168: BSU08520
Entry
BSU08520          CDS       T00010                                 

Symbol
recX
Name
(RefSeq) regulatory protein RecX
  KO
K03565  regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU08520 (recX)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BSU08520 (recX)
SSDB
Motif
Pfam: RecX DUF494 DUF4136
Other DBs
NCBI-GeneID: 939727
NCBI-ProteinID: NP_388733
Pasteur: BG12882
BSORF: BG12882
UniProt: O31575 A0A6M4JE48
Position
925633..926427
AA seq 264 aa
MPFITKISTQKKNTERFNIFLDDKYAFSVDADVLVKFELKKGKELDDLDIIEIQYGDEVK
KGFNRALDFLSYRMRSTKEVEDHLKKKETSPPVIAEVIHRLNDYKYLNDQEFAAAYVSTH
KKTNGKGPDVLFRELRAKGIDDDTIKEALSSFSFEDQTREAVKHVEKLLKKDKKLSTKEL
KQRAQLQLQRKGFSFDVISAAMDQIEYENDEDTEKEALRLHAEKAFRKYRYDGSYESAMK
VKQFLFRKGFSLDLIEQLLQEEEY
NT seq 795 nt   +upstreamnt  +downstreamnt
atgccgtttattacaaaaatatcaacgcaaaaaaagaatacggaacgcttcaatattttt
ctggatgataaatacgccttcagcgtggacgcggatgtgctcgtgaaatttgagctcaag
aagggaaaagaactcgatgatcttgacatcattgagattcaatacggcgatgaagtgaag
aaaggcttcaaccgtgcgcttgactttttatcctatcgaatgcggtcgacgaaagaggtc
gaggatcacttaaagaaaaaagaaacctcgccccccgtcattgcggaagtcatccatagg
cttaacgattacaagtacttaaacgaccaggaatttgccgcagcctatgtcagcactcac
aaaaaaacaaacggaaaaggccctgatgttttgttcagagagctaagagcgaagggaatt
gatgacgatacaattaaggaggcgctaagttccttttcctttgaagatcagacaagagaa
gcggtcaagcatgttgaaaagcttctcaaaaaagataaaaagctttcgacgaaagaactc
aaacagcgcgcccagctgcagcttcagcgcaagggcttctcatttgatgttatcagcgcg
gcgatggatcagattgaatatgaaaatgatgaagacacagagaaagaagcgctgcgcctt
cacgcggaaaaagcgtttagaaaataccgctatgacggctcatatgaaagcgccatgaag
gtcaaacaatttttattccgcaaaggattctcactcgatttaatcgagcaattactgcag
gaagaggagtactga

DBGET integrated database retrieval system