KEGG   Bacillus subtilis subsp. subtilis 168: BSU08540
Entry
BSU08540          CDS       T00010                                 

Symbol
yfhI
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 939712
NCBI-ProteinID: NP_388735
Pasteur: BG12884
BSORF: BG12884
UniProt: O31577 A0A6M4JG53
Position
926886..928079
AA seq 397 aa
MSIKNPSVKFIIFVLMICTFSIGYTEYAVMGILTSIANDFHIQVSSAGLLVTAYAASVCL
TGPLVTIISVKLPRKPVLLGLMAIFILSNLMSALAPNFAVLAISRILSASIHGAFFAIAM
VFASEMVPPEKRAAAAASMNGGLTVALMLGVPFGSYLGDVLNWRAVFSIITALGVIGFLG
LMAAVPNRKPKVIPMLMNEWGVFKHKQVLFSFAITILGYSGVFIAYTFIEPILRHSAGFS
TVGITGALFAYGLGGVAGNFFAGKVPLPLLTRTMIGVMIGLIGVLAVFPYIAIYPAAAIV
ATFLFGACAFGTPPLLQTKVISSSEGGTTIAAAVSVSAFNLANALGAWIGGMILNGTGSY
SWLFAGGALMTACGLVLSTFAHLSEKKSVYEYQVNKG
NT seq 1194 nt   +upstreamnt  +downstreamnt
ttgagtatcaaaaacccatctgtaaaatttattatatttgttcttatgatttgtacattt
tcaatcggctatacagaatacgcggtgatgggtattttgacgtcgattgccaatgacttt
catatacaggtttcatccgcagggcttcttgtcacggcttatgcggcaagcgtttgtttg
acagggccgctcgtcaccatcatttccgtcaagcttccgagaaagcctgtgcttcttggg
ctgatggcgatatttatcctttccaacctgatgagcgcactggcgccgaattttgcggta
ttggccatttcaagaattttatctgcgtccattcacggcgctttcttcgcgattgccatg
gtattcgcaagtgaaatggttccgccggaaaagcgtgctgcagctgctgcttcaatgaac
ggcggactgacagtggctctaatgcttggtgttccattcggctcttatctcggagatgtc
ctgaattggagagcggtgttttccatcattacggcacttggtgtcatcggatttttaggc
cttatggctgccgtgccgaacagaaaaccaaaagtgatcccaatgcttatgaatgagtgg
ggtgtttttaaacacaaacaagtgctgttttccttcgcgattaccattttaggctattcc
ggtgtctttatcgcctacacctttatcgaacccattttgaggcattcagccggattcagc
acggttggcattacaggtgctctctttgcgtatggattgggaggcgttgccgggaatttc
tttgctggaaaggtaccgctgcctttgctgactcggacgatgatcggcgtaatgatcggt
ttaatcggtgttctggctgtatttccttacatcgccatttacccggctgcagccattgtg
gcaacgttcctattcggggcatgcgcattcggcacgccgcctcttctgcaaacaaaggtc
atttcctcatctgagggcggcacaaccattgccgcagctgtcagcgtatcagcatttaac
cttgccaatgcccttggtgcatggatcggcggaatgattttaaacggaacaggctcttat
tcctggctgtttgcaggaggtgcgcttatgaccgcatgcggacttgtgctttctaccttc
gcacacttatcagaaaagaagagcgtctacgaatatcaagtcaataaagggtaa

DBGET integrated database retrieval system