KEGG   Bacillus subtilis subsp. subtilis 168: BSU08550
Entry
BSU08550          CDS       T00010                                 

Symbol
sspK
Name
(RefSeq) small acid-soluble spore protein K
  KO
K06428  small acid-soluble spore protein K (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU08550 (sspK)
SSDB
Motif
Pfam: SspK
Other DBs
NCBI-GeneID: 2914224
NCBI-ProteinID: YP_054573
Pasteur: BG14175
BSORF: BG14175
UniProt: Q7WY75 A0A6M4JGP7
Position
complement(928112..928264)
AA seq 50 aa
MVRNKEKGFPYENENKFQGEPRAKDDYASKRADGSINQHPQERMRASGKR
NT seq 153 nt   +upstreamnt  +downstreamnt
atggtccgaaataaagaaaaaggatttccttacgaaaacgaaaacaaatttcagggtgaa
ccgagagcaaaggacgactatgcttcaaagcgtgctgacggatctatcaatcagcatcct
caagaaagaatgagagcctcaggcaaacggtaa

DBGET integrated database retrieval system