KEGG   Bacillus subtilis subsp. subtilis 168: BSU08560
Entry
BSU08560          CDS       T00010                                 

Symbol
yfhJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WVELL Toprim_3
Other DBs
NCBI-GeneID: 936188
NCBI-ProteinID: NP_388736
Pasteur: BG12885
BSORF: BG12885
UniProt: O31578 A0A6M4JGL8
Position
928389..928658
AA seq 89 aa
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWI
ENYGGQLHLFQSSRNDVNDYLNQSRGLLH
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaatatgtacattgagaaactgactaatctgcttctggaaaagaacgagatgatcagc
tatatacaggcaaaaacgtgggtggaattgttatggagcgatttcgaagcaacctacgca
aaagccggacacgcctatcaaggtgaaaaaatgactgaaaaaatcgtcacacaatggatt
gaaaactatggcggccagctccacctttttcaaagctcccgtaacgacgtgaatgattac
ttaaatcaaagcagaggccttttgcattaa

DBGET integrated database retrieval system