KEGG   Bacillus subtilis subsp. subtilis 168: BSU08570
Entry
BSU08570          CDS       T00010                                 

Symbol
yfhK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SH3_3
Other DBs
NCBI-GeneID: 939215
NCBI-ProteinID: NP_388737
Pasteur: BG12886
BSORF: BG12886
UniProt: O31579 A0A6M4JG74
Position
928803..929321
AA seq 172 aa
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNH
EGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPT
PENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaaaagaaacaagtaatgctcgctttaacagctgccgcaggactgggtttgacagca
cttcattccgctcccgcagcaaaagctgcgccccttcacgacatatctgtcagcatgcca
tcatccgatacttacatcataaaagcaggaaagctgaatgtccggactgagccaaatcat
gaaggtgatattctcggcactgtatcatcagaacaaaaggtaaaagtcgataggttcgta
aatgccgattgggctcaaattcatttcaaaggaaagaaagcatatatttcaactcacttt
ttaatgaaaaccgcaagccaagcgaaaacaacgaaacagacagccttctatacaccgacg
cccgaaaacggaaaagctaagcagctctcatctggaacagaggtgacaatacttgggtgg
ggattcagtgaaaacggcggatttgacttcacttgggcgttcgtggattatggcggagtt
aaaggctatattcacacaaaggatttacaaatgcgataa

DBGET integrated database retrieval system