KEGG   Bacillus subtilis subsp. subtilis 168: BSU08580
Entry
BSU08580          CDS       T00010                                 

Gene name
yfhL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SdpI DUF3784 DUF6232 SLATT_4 DUF3119 FA_desaturase DUF2207
Other DBs
NCBI-GeneID: 939228
NCBI-ProteinID: NP_388738
Pasteur: BG12887
BSORF: BG12887
UniProt: O31580 A0A6M4JHL2
Position
929406..929738
AA seq 110 aa
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLV
IAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
NT seq 333 nt   +upstreamnt  +downstreamnt
atgacgggtttagtcggcggagggcttatgatcattgcgggcatactgatcaaactgttt
cctcccaaatcgatcaacagtgtgtacggatacagaacgagacgctcaatgtcagatcaa
agattatggaatgaagcgaaccgttacagtgcatcattaatgatcctgtcaggcttggtg
attgcgggaatgggtttgctgctgggatcaaacttgtttattcttcagcttatcctgctg
attgccgcctgtgtcataacatttatgctaacggagaaaaggctgaaaatcatgacgcac
agtcaaggaggagatagaagtggacggagttaa

DBGET integrated database retrieval system