KEGG   Bacillus subtilis subsp. subtilis 168: BSU08590
Entry
BSU08590          CDS       T00010                                 

Symbol
yfhM
Name
(RefSeq) AB hydrolase superfamily protein YfhM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 PGAP1 DLH
Other DBs
NCBI-GeneID: 936187
NCBI-ProteinID: NP_388739
Pasteur: BG12888
BSORF: BG12888
UniProt: O31581 A0A6M3Z8R3
Position
929725..930585
AA seq 286 aa
MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPD
QRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYL
EKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSD
RPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFL
SRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
NT seq 861 nt   +upstreamnt  +downstreamnt
gtggacggagttaaatgccagtttgtcaatacgaacggaatcacgcttcacgttgcagcc
gcaggacgggaagatggcccgttaattgtcctgctccatggatttcctgagttttggtac
ggctggaaaaatcaaatcaaaccgcttgttgatgcgggttaccgggtcattgctcctgat
cagcggggctacaatctcagtgacaaaccggaaggaattgattcgtatcggattgataca
ttaagagatgatatcatcgggcttattacgcaattcactgatgaaaaagcaattgtcatc
ggtcatgactggggaggagctgtcgcatggcatttggcttccacacgcccggaatatctt
gaaaaactgatcgcgatcaatatcccgcacccgcacgtcatgaaaaccgtaacgccgctt
tatccgccgcaatggctgaaaagctcgtatatcgcatacttccagctgcccgatataccg
gaggcatcactaagggaaaatgattatgatacattagacaaagcgattggattatccgac
cgtcccgcgctttttacatccgaggatgtcagcaggtacaaagaagcgtggaagcagccg
ggcgcgctgacagctatgctgaactggtacagagccctcagaaaaggaagcttggcagag
aaaccctcttacgaaacagtaccttaccgaatgatctggggaatggaagaccgctttttg
agcagaaagcttgcgaaagagacggaaaggcattgcccgaatggacatctcatctttgtt
gatgaagcttcccattggattaaccacgaaaagccagccatcgtcaatcagctgattttg
gaatatcttaagaaccaataa

DBGET integrated database retrieval system