KEGG   Bacillus subtilis subsp. subtilis 168: BSU08600
Entry
BSU08600          CDS       T00010                                 

Symbol
csbB
Name
(RefSeq) glycosyltransferase CsbB
  KO
K20534  polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
    BSU08600 (csbB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU08600 (csbB)
Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
 O-antigen repeat unit
  BSU08600 (csbB)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 DUF5338
Other DBs
NCBI-GeneID: 939717
NCBI-ProteinID: NP_388740
Pasteur: BG11834
BSORF: BG11834
UniProt: Q45539
Position
930818..931807
AA seq 329 aa
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAAT
CSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVI
AQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSK
GLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILL
LSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPH
YLIKEANIPNKDLPETNELKSMRRLTKMH
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaagcaaggattaatctcgattattatcccgtcttacaatgaagggtataatgttaaa
ctcattcatgaatctttaaaaaaggaatttaaaaacattcattatgactatgaaatattc
ttcataaacgacggaagtgttgatgacacgcttcagcagatcaaagacttggcagcgacg
tgcagccgggtaaaatatatatctttttctcgaaactttggaaaagaagccgcaattttg
gcgggctttgagcatgttcagggcgaggcggttattgtcatggatgccgatctgcagcat
ccgacatatttgctgaaggaatttatcaaaggctacgaagaagggtatgaccaagtcatt
gcccaaaggaacagaaaaggggacagctttgtccgctcactcttatcatctatgtattac
aagttcattaataaagcggtggaagtcgatttgcgtgacggtgtcggtgacttcagattg
ttaagccgccaagctgtgaatgcacttttgaagctgagcgaaggaaaccgcttctcaaaa
ggccttttttgctggattggctttgatcagaaaattgtattttatgaaaatgtcgaacga
aaaaacggcacctccaaatggtcgttcagcagtctgtttaactacggaatggacggcgtc
gtttcatttaatcataagccgctgagattatgtttttatacaggcattttcatcctgctg
ctttccatcatttatatcattgccacattcgttaaaattctgactaacggtatttctgtg
cctgggtatttcaccattatctcagcagtgttatttctcggcggagtacagctgttaagt
cttggaataataggtgaatatatcggccgaatctattatgaaacaaaaaaacgcccgcat
tatttgatcaaagaggcgaatatcccgaacaaagacctgcctgaaacgaacgaattaaaa
agcatgcggcgtctgacaaaaatgcactga

DBGET integrated database retrieval system