KEGG   Bacillus subtilis subsp. subtilis 168: BSU08610
Entry
BSU08610          CDS       T00010                                 

Symbol
yfhO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfhO
Other DBs
NCBI-GeneID: 936195
NCBI-ProteinID: NP_388741
Pasteur: BG12889
BSORF: BG12889
UniProt: O31582 A0A6M3Z8L3
Position
931879..934464
AA seq 861 aa
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFF
YNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGETDTLFWAESAVFISIFK
LSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAE
KIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFL
VSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLF
IISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLS
QLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKR
AKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKED
DDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASL
GDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSES
ELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGEN
GGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFTLKVNDYVTTRKSNKSIYKTGVNNITV
RVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFSYHL
SKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAI
ISLVSLLLAVFYIRRKKPGSI
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgaaaagaaaacatatcatgatctatgcggccagtttgctggtgtccgttctggcacac
gctttttttgtgaaagaatgggcggaaggcaggtatatgacaggtccgggtgacgggctt
gcgcaaatgatcgtatttaaaaaattattatttgaccaatatacacacgggaattttttc
tacaattattcattcggacttggcggcggcacattcagtcagctcggctattatttttct
gcgtcttttctttttcttgctgtgtctgccgctgtttggctgcttcaagccgtccagctg
atcggagaaacggatacgcttttttgggcagagtcagctgtttttatcagtattttcaaa
ttgagcttgatcatctttacgtccgcttctgtttttcattatcttcttaagcacagggcg
gcatcgttcacgggagccgtgttatacggcgtctcaattatttatttccgtcacgaagcg
tattgggaatttttcaccgatacaatggtttggcttccgctgcttgtgcttggcgcagaa
aaaattattagagagcggcgtccggcgtggtttatcgttgcgtgttcgctgacgttaatc
aacaatttttactttgcatacataaaccttatattcatcggaatctatgtgctgttcaga
tggctgatccgtttggaaccacatgaagagaaaagatggattcaaatcagattatttctc
gtttcaggcttcatttcttttggcatcagtgcggcggcgtttgtgccggtagtatacggt
tttttaaacaacctgcgccctccatacagccagaaaatagagtggctcaatttcgatgat
aatatcttattttcgagccggatcatcattgtgccggccgcttttctgctgtttttgttt
attatttctttttacaaaaaccgtgtgtttcgtctctttgccgggttgagcctgctgttt
attctgtttcatttcagtccgtatgcggcaagcgtctttaacggtttttccgccccgcaa
aaccggtttgaatatgttctggcctttaccattgcgggagcagctgcggctggtttgtca
cagctgtctgaattgaaacggaaagaactgctcccggccgcagctgtcgtcctgcttctt
tacttgtatcatatccaaaggtataagctcgatatatggaagcctgcgaatgaaagtatt
ctattgctcttactcatgacaatcgcagccttgtttgctgcagcttttgcgaaaaaacgg
gcaaaaatggctgtgtacggtataatcattctttcttcgctgtttgtcgccaactcctat
caaaaatacgcgctctcagaaggcggcgatttggacagtgtgacaaaagaatatcttaca
agtgaggaatacagagggcgggaatcatctgagctcatcagacgtttacagaaggaagac
gatgacccgctcatgagaatcgactggatgaacggggtccgcaataatacgccaatcatt
tacggatttaatggcttcagcgcgtattccagcattttaaacaaagatctgctggccttc
tattggaatgatttaagcatcgatatgggcagggaaagcgtcagccgttacgcgtcattg
ggagacagggcgaatttatacagcctgctttacggcaaatattatatgaccgaaaaaaca
aacgaagccagcgtcccgtacggcttcaaaaagcatttagaaacagagcattatgcagtt
tatgagaatcagtacatgcttccattcgttaaaacagcggatgccatatacagcgaaagt
gagctggaccgattgcccgctcttgcgaaagaacaggcgatgctgaaaggaattatatta
aaagatccatcaggaaaaacggagcagacaccaaaaccgtccaatttgatcaccaagtcg
gacatcaccgcaaaacaagcccagtatcaaaacgggctgctaaccgtaactggagaaaac
ggaggagagctgatcatcaccccgaaacagccatcatccgctccgggagactactatgtc
agcttttatttgaaaagcaaagcaaaagacaaaggatttacattaaaggtaaatgattat
gtcacaacaaggaaatcgaacaaatcgatctataaaaccggagtaaataatataacggta
agagtgcctaaatcaggccatatctcaatcaatcttccgaaaggaacctatgagctgaga
aacatagcgctctatgaagaaaattaccaaacgctgaaaaacgctgtaatgcaaaataaa
acagagaaagcagacaaactgaattggaacaaaaatcgactgaccttttcctatcatctg
tcaaaagaccagtacatcatgcttccgatcccatatgaaaaaggctgggagctgaagatc
aacggaaaaacacagaagatcgaaaaagcggattatgcttttataggcttcaaggcgcaa
aagggagacaatcacattgagctgacttactatccgccatacttcaaaatatcggcgatc
atatctctcgtcagtctgctgcttgctgttttttatataagacgtaaaaagcccggctct
atatag

DBGET integrated database retrieval system