KEGG   Bacillus subtilis subsp. subtilis 168: BSU08620
Entry
BSU08620          CDS       T00010                                 

Symbol
yfhP
Name
(RefSeq) hypothetical protein
  KO
K07038  inner membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU08620 (yfhP)
SSDB
Motif
Pfam: YdjM
Other DBs
NCBI-GeneID: 936190
NCBI-ProteinID: NP_388742
Pasteur: BG12890
BSORF: BG12890
UniProt: O31583 A0A6M4JE58
Position
complement(934457..935440)
AA seq 327 aa
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIR
NHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAI
RPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQL
RIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVP
ETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGH
DLTIRSSYTGWIFSEEKLQKKLKLGSI
NT seq 984 nt   +upstreamnt  +downstreamnt
atggatacgggcacacatgtcgttatgggcatcgcactgggcggtattgcgacgcttgat
cctgttgtcggatcagatccggcaatggctcacgctgttatgatcgcaacgcttgcgggc
tctcaggctccggatattgatactgtgttaaagcttaaaaacaatgctgtttatataagg
aatcacagaggatttacccattcaattcccgccgttttgttttggtctgtcatcatcccg
gcgattctgtatttattttatcctcaggccgattttctgcacctgtggctgtggacactg
ctggcagtcgttctgcatgtctttgttgatatattcaacgcctatggaacacaagccatt
cgtccgttttcgaaaaaatgggttgcgctcgggctgattaatacgtttgatccgtttatt
tttatcagccatctggcagctatcgcgatttggtatgcaggcgggagtcccggcatcacg
tttctcagcttatatatcatattggtaggctactacttggtgcgcctgatcatgcagctg
agaattaaacggaagcttcatgagatgattcatgatgagatcgaaagcattattatttct
ccaacgatgaaattcaggcaatggcgaatcgcagtgacgacagcacatgctttctatgta
ggaagaagcatggaaggacatgtcgtgattctggatacatttaatcgggtgcctgttcct
gaaaccgatgtaatgcatgcggcaaagcaggatgataacatcgcggcgtttctgtccttt
tctccggtataccggtgggaagtggatacgtttaaagatcattatgaggtgagatttatc
gacctgcgttatcggagcaaaggccattatccgtttgtcgcaattgttcatatcggccat
gatctcacgattcgttcatcctatacgggatggatattcagcgaagaaaaacttcagaaa
aaattaaagctcggctctatatag

DBGET integrated database retrieval system