KEGG   Bacillus subtilis subsp. subtilis 168: BSU08640
Entry
BSU08640          CDS       T00010                                 

Symbol
yfhS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936193
NCBI-ProteinID: NP_388744
Pasteur: BG12892
BSORF: BG12892
UniProt: O31585 A0A6M3Z8Q3
Position
complement(936773..936997)
AA seq 74 aa
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKR
NEADYSHGTRVSYD
NT seq 225 nt   +upstreamnt  +downstreamnt
atgtatgtcggacgtgatatgagcgaattgaacatggtttccaaaaaagattggaagaac
agtgaactcgcttattttcatcatgcctttcagcaaattatgccttatttgaacgaagaa
ggccaatcaaaataccgggaattaacgcaagaaattgaagcgcgcggcggaatgaagcgc
aatgaagcggactacagccacggcacgcgcgtctcttacgattaa

DBGET integrated database retrieval system