KEGG   Bacillus subtilis subsp. subtilis 168: BSU08650
Entry
BSU08650          CDS       T00010                                 

Symbol
fabL
Name
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADPH] FabL
  KO
K10780  enoyl-[acyl-carrier protein] reductase III [EC:1.3.1.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU08650 (fabL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU08650 (fabL)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.104  enoyl-[acyl-carrier-protein] reductase (NADPH)
     BSU08650 (fabL)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU08650 (fabL)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Aminotran_5 Epimerase
Other DBs
NCBI-GeneID: 939223
NCBI-ProteinID: NP_388745
Pasteur: BG12221
BSORF: BG12221
UniProt: P71079 A0A6M3ZC25
Structure
PDB: 
3OID 3OIC

Position
937079..937831
AA seq 250 aa
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVK
ANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFC
AQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVN
AVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTI
IVDGGRSLLV
NT seq 753 nt   +upstreamnt  +downstreamnt
atggaacaaaataaatgtgcactcgtaacaggaagcagccgcggtgtcggaaaagcggcc
gcgatcagacttgctgagaacggctataacatcgtcattaactatgcacgcagcaaaaaa
gcagcattagaaacagcggaagaaatcgaaaagcttggcgttaaagtgcttgtcgtaaaa
gcaaacgtaggacagcctgcaaaaatcaaagaaatgtttcagcaaattgatgaaacgttc
ggcagacttgatgtttttgtcaataatgccgcttcaggagtactaagacctgtcatggaa
ttagaagaaacacactgggactggacgatgaacattaatgcgaaagcattgcttttctgc
gctcaggaagctgccaagctaatggagaagaacggtggcgggcatattgtcagcattagt
tcattaggctctatccgctatcttgaaaactacaccacggtcggtgtatcaaaagcagcg
ttagaggctttaacccgttatcttgccgttgagctttcaccaaaacaaattatcgtcaat
gctgtttcaggcggagcgatcgacacagatgcgctgaagcacttcccgaatagagaagat
ctgcttgaggatgcgcgccaaaatacgccggcgggacgcatggtcgaaattaaagacatg
gttgatactgtggagtttctagtgtcttccaaggctgacatgatccgcggacagacaatt
atcgttgacggcggacgctcactgctcgtttaa

DBGET integrated database retrieval system