KEGG   Bacillus subtilis subsp. subtilis 168: BSU08660
Entry
BSU08660          CDS       T00010                                 

Symbol
sspE
Name
(RefSeq) small acid-soluble spore protein gamma-type
  KO
K06422  small acid-soluble spore protein E (minor gamma-type SASP)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU08660 (sspE)
SSDB
Motif
Pfam: SASP_gamma
Other DBs
NCBI-GeneID: 939716
NCBI-ProteinID: NP_388746
Pasteur: BG10789
BSORF: BG10789
UniProt: P07784 A0A6M4JGM6
Position
937900..938154
AA seq 84 aa
MANSNNFSKTNAQQVRKQNQQSAAGQGQFGTEFASETNAQQVRKQNQQSAGQQGQFGTEF
ASETDAQQVRQQNQSAEQNKQQNS
NT seq 255 nt   +upstreamnt  +downstreamnt
atggctaactcaaataacttcagcaaaacaaacgctcaacaagttagaaaacaaaaccaa
caatcagctgctggtcaaggtcaatttggcactgaatttgctagcgaaacaaacgctcag
caagtcagaaaacaaaaccagcaatcagctggacaacaaggtcaattcggcactgaattc
gctagtgaaactgacgcacagcaggtaagacagcaaaaccaatctgctgaacaaaacaaa
caacaaaacagctaa

DBGET integrated database retrieval system