KEGG   Bacillus subtilis subsp. subtilis 168: BSU08670
Entry
BSU08670          CDS       T00010                                 

Symbol
ygaB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YgaB DUF484 TMPIT Bcr-Abl_Oligo DUF16
Other DBs
NCBI-GeneID: 939220
NCBI-ProteinID: NP_388747
Pasteur: BG12222
BSORF: BG12222
UniProt: P71080
Position
938243..938587
AA seq 114 aa
MSQRVCFMEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIE
AELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagtcaaagggtttgctttatggagatcgaaatgattaaaggaggaaatgtttatact
ttcatcaggctgaaggaggaaccgatgaccgaatttgaaaagctggtaagtgaacagatg
aaaacgatggataagcttctcgatctccaatcagagctcgaccgctgcaaacaaattgag
gcggaactccggcatttggaaagggatgcaaggctgcgtgggattcaggctgaaattgcg
gtaaaacggaaacaccttgccgatatacaggatatgtttcaaaagcagacagagcaggtc
attcgttcatatcgcagctcagaaaagccgtcttcctttgtgtag

DBGET integrated database retrieval system