KEGG   Bacillus subtilis subsp. subtilis 168: BSU08680
Entry
BSU08680          CDS       T00010                                 

Symbol
ygaC
Name
(RefSeq) hypothetical protein
  KO
K07586  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU08680 (ygaC)
SSDB
Motif
Pfam: DUF402
Other DBs
NCBI-GeneID: 936192
NCBI-ProteinID: NP_388748
Pasteur: BG12223
BSORF: BG12223
UniProt: Q796Z1 A0A6M3Z989
Position
938731..939261
AA seq 176 aa
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREP
AICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILD
EDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgggctatcccaaggaaggagaaaccattcaaattcacagctataagcacaacgggctg
attcatagaatttggaatgagacaacaatcttaaaaagtacagaaatgtgtgtcatcgga
gccaatgaccggacgatggtaaccgaatcagacggccggacatggataaccagagagccc
gcaatctgttattttcacgcaagacaatggtttaatgtcatcgggatgctgagggaagac
ggggttcattattattgcaacatcagttctccgtttgcctatgatggcgaagcaattaaa
tatattgattatgacttagatgttaaggtttttcctgacatgacctacaatattctcgat
gaagacgaatatgatgatcatcggaaagccatgaattatccaaaagaaatcgacagtatt
ttaagagactacttaaatacgctgctccattggattcaccagcgtcagggaccgtttgcg
cccgagtttgtcgatatgtggtatgaacggtatttgcgctatacaaaataa

DBGET integrated database retrieval system