KEGG   Bacillus subtilis subsp. subtilis 168: BSU08700
Entry
BSU08700          CDS       T00010                                 

Symbol
ygaE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ArAE_1 FUSC FUSC_2 ALMT
Other DBs
NCBI-GeneID: 939721
NCBI-ProteinID: NP_388750
Pasteur: BG12225
BSORF: BG12225
UniProt: P71083 A0A6M3Z8S5
Position
complement(941168..942229)
AA seq 353 aa
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANII
GAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMF
ALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILK
EDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHR
LENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFL
KNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaaacttggtgcccgcattttcaaaaccgggattgcgattacacttgccctttatttg
gcttcgtggatcgggcttcccgcgccgattttcgctggaattgcagcgatatttgcgatc
cagccgtcgatttaccgctcttttctcattattattgaccaggttcaagcaaatatcatc
ggagctgtgattgccacagtgttcggccttattttcggacccagcccgattatgatcggg
ttaacagcagttattgtcattacaatcatgctgaaacttaaaattgaacatacaatttca
attgctcttgtaacagtcattgcgatattagaatctgccggtgacgactttttaatgttc
gcgctgatcagaacaagcacagtcatcttaggggtgctttcttcctttatcgtcaacctt
gtgtttttgcctcctaagtacgaaacaaagctgattcataataccgtcgaaaacaccgaa
gaaattatgaagtggatcagattgtccatgcggcagtcgacagagcattcgattttgaaa
gaggatattgaaaaactgaaagaaaaaatgatcaagcttgatcagacatatcttctatat
aaagaagaaagaagttactttaagaaaacgacttatgtgaaatcaagaaagcttgtcctg
ttcagacaggccattattactgcaaatcgggcgcttgatacattgaagaagctgcatcgt
ctggaaaacgagatctatcatatgccggaagagtttcaggaaacattgactgaagaactt
gattacctgctttactggcacgagcggattttgatgaggtttgtcggaaaaatcaagccg
catgatgacgcggttgaagaaggcatccggtataagcagcttttaacaaagtcattttta
aaaaatcagcagaatacggatgaggagcttattgattacaacatgctcaatattatggca
agcgccgtggaatatcgcgagcagcttgaacatttagaaacacttatcacaagttttcaa
acgtatcatccgaaagactgcgaaatagaaacagaagagtaa

DBGET integrated database retrieval system