KEGG   Bacillus subtilis subsp. subtilis 168: BSU08710
Entry
BSU08710          CDS       T00010                                 

Symbol
gsaB
Name
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU08710 (gsaB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU08710 (gsaB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BSU08710 (gsaB)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU08710 (gsaB)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 936194
NCBI-ProteinID: NP_388751
Pasteur: BG11943
BSORF: BG11943
UniProt: P71084 A0A6M4JLB2
Position
complement(942449..943738)
AA seq 429 aa
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAA
YGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEA
VMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVIT
VPFNDIDSYKAALEKWGSEIAAVLVEPIVGNFGIVEPKEGFLEQVNELTHNAGALVIYDE
VITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTM
AGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVY
FSDEKVENYEQAERSDGETFSTFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLTAV
EDAFKHLKN
NT seq 1290 nt   +upstreamnt  +downstreamnt
ttgcatacaaaatcaattgaacttcacaatgaggcattacagcacattgtcggcggtgta
aacagcccgtctagatcatataaagcagtcggcggcggttctcctgttgcaatggagaaa
gcaagcggcgcttatttttgggatgtggacggcaacaaatacatcgattatttagcggcg
tacggtccgattattacaggacatgcccatccgcatattacagaagcgattaaaaaagca
gcagagaacggtgtattgtatggaacaccaacgaaacacgaggttacatttgcaaaaatg
ctcaaagaagccattcccgctatggacaaagtaagattcgtcaattcgggtacagaagcc
gttatgacgaccatccgcgtggctcgcgcatatacaggccggacaaaaatcattaaattt
gcgggctgctatcacgggcattcggaccttgtgcttgtcgccgcaggctccggcccgtct
actctcggcacaccagactcagccggtgtaccgaaaagcattgcaaacgaagtgatcaca
gtaccatttaatgatatcgatagctataaagcagctcttgaaaaatggggcagtgaaatc
gcggcggttctcgttgaaccgattgtcggcaacttcggtatcgtggagccgaaagagggc
ttcttagaacaagtaaatgaattaacacataatgcaggggctctcgttatttacgatgaa
gtcattacggctttccgctttatgtatggcggcgcgcaggatctcttacaggtgaaacca
gatttaacagcactcgggaaaattatcggcggcggacttccgattggggcctatggcggc
aaacaagaaatcatggagcaggtagctccgctagggcctgcttatcaggcaggaacaatg
gcagggaaccccgcttccatcctatcaggcatcgcttgtctggaagtgctcaaagaaaaa
ggcgtgtatgaaaagcttgatcaccttggcgctatgcttgaggaaggcattttgaagcac
gcagaaacacacggcatcaccattacggtcaaccggttaaaaggtgcgctcacggtatac
ttctctgatgagaaagtggaaaattacgagcaggctgaacggagtgacggagaaacattc
tctacgtttttcaagctgatgctggaacgcggaattaatttagcaccttctaagtatgaa
gcttggtttattaccacagcacatacagagcaggatattaaagacacgcttacagcggtc
gaggatgcatttaaacatctaaaaaactag

DBGET integrated database retrieval system