KEGG   Bacillus subtilis subsp. subtilis 168: BSU08720
Entry
BSU08720          CDS       T00010                                 

Symbol
ygaF
Name
(RefSeq) peroxiredoxin YgaF
  KO
K03564  thioredoxin-dependent peroxiredoxin [EC:1.11.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU08720 (ygaF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     BSU08720 (ygaF)
SSDB
Motif
Pfam: AhpC-TSA Redoxin SCO1-SenC AhpC-TSA_2 Thioredoxin_8
Other DBs
NCBI-GeneID: 2914207
NCBI-ProteinID: YP_054574
Pasteur: BG12226
BSORF: BG12226
UniProt: Q796Y8 A0A6M3Z8S4
Position
943891..944364
AA seq 157 aa
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFA
ELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIER
STFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgactatagaaatcggacaaaaagcgcctgatcttgagttaaaaggtgatcatggggaa
acagtaaaattatcggattataaaggaaagtacatcgtgctttatttttatccaaaggac
atgacaccgggatgtacaactgaagcatgcgattttcgggacagtcacgaaagcttcgcc
gaactggatgccgtcattatcggcgtcagcccggacagccaggaaaaacacggaaaattt
aaagagaagcataaccttccatttctgcttcttgttgatgacgagcataagctggcggaa
gcatttgatgtgtggaagctgaagaaaaacttcggaaaagagtatatgggaatcgagcgt
tccacttttttaattgataaagaaggccggctcattaaagaatggagaaaagtaaaagta
aaggaccatgtagccgaagcgcttcaaaccctcaaagatatgtctgaaaagtaa

DBGET integrated database retrieval system