KEGG   Bacillus subtilis subsp. subtilis 168: BSU08730Help
Entry
BSU08730          CDS       T00010                                 

Gene name
perR
Definition
(RefSeq) peroxide operon regulator
  KO
K09825  Fur family transcriptional regulator, peroxide stress response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU08730 (perR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    BSU08730 (perR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR Cytochrom_C550 HTH_20 E6 HTH_5 Type2_restr_D3
Motif
Other DBs
NCBI-GeneID: 939227
NCBI-ProteinID: NP_388753
Pasteur: BG12227
BSORF: BG12227
UniProt: P71086
Structure
PDB: 

Position
944487..944924
Genome map
AA seq 145 aa AA seqDB search
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVY
NNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHV
TGFKVSHHRLEIYGVCQECSKKENH
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacatgaactaaaagaagccttagaaacgttgaaggaaaccggagttcgcatt
actcctcaacgtcatgcgattctggaatatctcgttaactctatggctcatccaacagcg
gacgatatatataaagctctggaagggaaatttcctaacatgagcgtagcgacggtatat
aacaatttgcgtgtgttccgggaatcaggtttggtaaaagagctcacatacggtgatgct
tccagcagattcgattttgtcacatccgatcactatcacgcgatttgcgaaaactgcggt
aaaattgtggacttccactacccgggccttgatgaagtggagcagctcgctgcccacgtc
acgggcttcaaggtaagccaccaccgtttagaaatttacggcgtctgccaagagtgttcg
aaaaaagaaaatcattaa

DBGET integrated database retrieval system