KEGG   Bacillus subtilis subsp. subtilis 168: BSU08740
Entry
BSU08740          CDS       T00010                                 

Symbol
ygzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2614 DZR
Other DBs
NCBI-GeneID: 2914245
NCBI-ProteinID: YP_054575
Pasteur: BG14192
BSORF: BG14192
UniProt: Q7WY74 A0A6M3Z8R2
Position
complement(944959..945312)
AA seq 117 aa
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWI
GMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
NT seq 354 nt   +upstreamnt  +downstreamnt
atggcgaaatactccagcaaaattaataaaatcagaacatttgcgttaagtttggttttc
gttgggtttatcattatgtacatcgggatctttttcaaagagtcagttttgctttctagt
ttgtttatgatacttgggcttttatccatcggtctcagcacggtagtttacttttggatc
ggaatgctttcgactaaagcggttcgcgtcatttgtccaggctgtgataaagagacaaag
gttttaggagtagtcgatatgtgcatgcattgccgagagccgctgactttagataaggga
ttagaaggaaaagaatttgatgagtcttataataaaaagaaaatgtcgaaataa

DBGET integrated database retrieval system