KEGG   Bacillus subtilis subsp. subtilis 168: BSU08750
Entry
BSU08750          CDS       T00010                                 

Symbol
ygxA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NTF-like HTH_52 CID
Other DBs
NCBI-GeneID: 936198
NCBI-ProteinID: NP_388755
Pasteur: BG10951
BSORF: BG10951
UniProt: Q04385 A0A6M4JG77
Position
945520..946404
AA seq 294 aa
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFD
HQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKL
KIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVR
QMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGE
LLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
NT seq 885 nt   +upstreamnt  +downstreamnt
atggaaaatcttctccgtccaatttaccaagaaagagcaagtcaccccaatacattggct
gtcattatgattgagagaagaaacaaaacatcttccttaacagataactttgatgcagct
ttgctggtgattgtaaaggatgctgatgagccagtttttataaagcattatgaatttgat
catcaaacagcttctttgcatgtggtaacagattctcagattcaagaatggattttgctt
ggaacaaatagaagaatcatagattggattgtaaatggcagagtcttgtttgaccgtaat
gaatacgtagttgaactgattgacaggctgaatacatttccgtttgccgaacgtaaactg
aagatcggactcgaatacggcaaattaatcagaaggtatgttgaagggaaagcttttttt
gaagccaatcaatttttagatgcctacaatgccgttgttcatgcgctgcatcatttagca
cgtattgaagtaatcgacagaggattccatcccgaaaccacggtgtggagccaagtgcgc
cagatggagccccaagtgtacaaattatattccgagctgattgaaagtcatgagagcctg
gaaaaaagacttgaattattattcttagcaaatgattttctcatccattccaaagccgag
atcggttcggcgcatcttttcgaagtaatgaaagaaaaagacatttggcaattcggtgag
cttcttcaacatcatgacctaaagcactttacccaagatcttggcgttatgcttgattac
ttgacggaaaagggacttatcaacgtctgccagatagaaacgaaaggacaggctgtctat
caccgaggatattcttttaaaaaaggtgttgactctgattcttga

DBGET integrated database retrieval system