KEGG   Bacillus subtilis subsp. subtilis 168: BSU08760Help
Entry
BSU08760          CDS       T00010                                 

Gene name
spo0M
Definition
(RefSeq) sporulation-control protein spo0M
  KO
K06377  sporulation-control protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU08760 (spo0M)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spo0M Arrestin_N Arrestin_C
Motif
Other DBs
NCBI-GeneID: 939725
NCBI-ProteinID: NP_388756
Pasteur: BG12229
BSORF: BG12229
UniProt: P71088
Structure
PDB: 

Position
complement(953373..954149)
Genome map
AA seq 258 aa AA seqDB search
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYV
IVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDI
QGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPT
SGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELE
DTEELEEVLEEILDQYAE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttttaagaagcttgcggcaagtgccggaattggagctgcaaaagtagataca
attttagaaaaagacgcatattttccaggagaagaagtacagggaacggtacatgtcaaa
ggcggaaaaatcgctcaggacatccgttatatcgatttacagcttagcacacggtatgtc
attgtaaaagacgatgaagagcaccggaaatacgctacaattcattctttccgggtcact
ggttcatttaccatacagcctggtgaagagcatcaatttccgttcacattcactctgcct
ctagatacgccgatcactgtagggaaagtagaggttgccgtggtgacagaccttgacatt
caaggcggtatcgataaatccgatcatgaccgcattttcgttgaagcgcacccttggatt
gaaaatgtgcttgaagcaatcgaaaacctgggcttccgtcttaacgaagcagactgcgaa
caagcgccctacttccagcgtcgtcttccgttcgttcaagaattcgaattcgttccgact
tccggatattatcgtcagatgcttgatgaattagagctcattttccttttagacgaagac
ggtttggaaatcattttcgaagtcgaccgcagagcaagaggactccgagggtggttggaa
gagatgtataatgacggagaacagcttgtacgcgtccgtttcagccaatcagagcttgaa
gatacagaagagctagaagaggtgctagaagagatcctagaccaatacgctgagtaa

DBGET integrated database retrieval system