KEGG   Bacillus subtilis subsp. subtilis 168: BSU08770
Entry
BSU08770          CDS       T00010                                 

Symbol
ygzA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936205
NCBI-ProteinID: NP_388757
Pasteur: BG12981
BSORF: BG12981
UniProt: O31586 A0A6M4JGN5
Position
954291..954494
AA seq 67 aa
MEVNKESLVADELHRMFLAGELQITVEEDINNISERLRNGDLSLDRLSGEDVFIKETVNE
ALRRVEQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaagtgaataaagaaagtttggttgcagatgaattacacagaatgtttttggctggt
gagctgcaaatcacagtagaggaggatataaacaatatttccgaaaggctgagaaacggc
gatctcagtttagaccgattaagcggtgaagacgtgtttataaaagaaacggtaaatgag
gctttaagaagagtggagcaataa

DBGET integrated database retrieval system