KEGG   Bacillus subtilis subsp. subtilis 168: BSU08780
Entry
BSU08780          CDS       T00010                                 

Symbol
ygaJ
Name
(RefSeq) peptidase YgaJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_S51 GATase_3
Other DBs
NCBI-GeneID: 939241
NCBI-ProteinID: NP_388758
Pasteur: BG12230
BSORF: BG12230
UniProt: P71089 A0A6M3ZIF6
Position
954893..955585
AA seq 230 aa
MKQIIAMGGGGFSMEPDNLSLDQYILNQSKREQPRICFLPTASGDSQNYIQRFYHAFQTL
DCVPSHLSLFKPPSSDLVSFVMEMDVIYVGGGNTRNLLVLWKEWGLDHILREAWKNGVVV
AGISAGAICWFEEGVTDSAGPLTSLKSLGFLQGSFCPHYDGEKDRRPAYHQLISNKFLCS
GYAADDGAALHFINDQLFQTVSSRSGAKAYRVMMAEHEIAEIPLPVKYLG
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaagcagattattgcgatggggggcgggggtttttcgatggagccggataatttgtcc
ctcgatcaatatatcctcaatcaatcaaaacgagagcagcctcgtatttgttttttgccg
acggcgagcggagattcccaaaactatattcagcggttttatcatgcatttcaaacattg
gattgcgtgccgtctcatttatctttgtttaagccaccatcatcagatttagtttctttt
gttatggaaatggacgtgatttatgttggcgggggaaatacgcggaatttacttgtgtta
tggaaagagtgggggctggaccatattctcagggaagcatggaagaacggtgtggttgta
gctggaataagtgccggtgcgatctgctggtttgaagaaggggtgacagattcagccgga
ccgctgacaagtttgaaaagtttaggttttttgcaagggagcttttgtccccattatgac
ggggaaaaggatcggagaccggcataccaccagctgatatctaacaagttcttatgcagt
ggctatgcagcggatgatggggctgctctccatttcataaatgatcagctgtttcagact
gtgagttcaaggtcgggtgcaaaggcatatcgggtgatgatggctgaacatgaaatagct
gaaatcccgttgccggtcaaatatttagggtga

DBGET integrated database retrieval system