KEGG   Bacillus subtilis subsp. subtilis 168: BSU08800
Entry
BSU08800          CDS       T00010                                 

Symbol
ygaK
Name
(RefSeq) FAD-linked oxidoreductase YgaK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 939245
NCBI-ProteinID: NP_388760
Pasteur: BG12231
BSORF: BG12231
UniProt: Q796Y5 A0A6M4JLC2
Position
complement(957705..959060)
AA seq 451 aa
MEKTKLTGRIVTRDDPDYNEARTNINLSLERYPDIIVFCQNKQDALNALKWARENRVPFR
IRGGRHSYENFSLLNNGLVIDLSEMKKITVNQDKKLAYIEAGAELGEVYRTLWQYGLTLP
AGTIANVGLTGLTLGGGIGLLTRAAGLTCDSLVQLEMIVADEKEGADLITVSCSNHPDLF
WASQGGGGGNFGIVTSMTFKAVPISQVSIFSITWGWDDFEEVYNTWQNWAPYTDDRLTSS
IEFWPKEVNRIEALGQFVGPKTELKKLLKPLLKAGSPTSGMVKTTPFIEAVTFFNSPGGN
QPQKMKRSGSFIEKPLSERAISTIKHFLEHAPNQNASVWQQALGGAAGRVAPDQTAFYYR
DAIIAQEYLTNWTSPGEKRQNVRWIEGLRTSLSKETMGDYVNWPDIEIRNWPRTYYGENV
ERLRRVKTTYDPENVFRFEQSIPPLRRSLFF
NT seq 1356 nt   +upstreamnt  +downstreamnt
gtggaaaagacaaaattgaccggacgtatcgtgacacgggatgatccggactataacgaa
gcaagaaccaatattaacctaagcttagaaaggtatcctgacatcattgtgttttgccaa
aacaaacaggatgcactcaatgcgctgaaatgggcgcgtgaaaaccgtgtgcctttccgt
attagaggcggcagacacagctatgagaacttttcccttttaaataacggtcttgttatt
gatttaagcgagatgaaaaaaataactgtgaatcaggataaaaagctggcctatattgaa
gcgggggctgaattgggagaagtctatcggacactctggcaatacggcctgacgcttccc
gcaggcaccattgctaatgtagggctcacaggtttaactctcggagggggaattggactt
ttaacaagggctgccggtcttacttgcgacagcctcgtgcagcttgagatgatcgtagca
gacgaaaaagagggcgctgatctgattacagtcagctgttcaaatcatccagacttattt
tgggcgtctcagggaggcggaggaggcaatttcggcatagtcacctccatgacatttaaa
gcagtgcccatctctcaagtgtcgattttttctattacatggggatgggatgattttgag
gaagtatataacacgtggcagaactgggccccgtatacagatgaccggcttacatcatca
atagagttttggcctaaagaagtaaaccgcatagaagccctcggccaatttgtcgggcca
aaaacagagttaaaaaaactgttaaagcctttattgaaagcaggaagtccgacaagcgga
atggtaaaaacaacgccattcattgaagcggtaaccttttttaacagcccgggaggcaat
cagcctcaaaaaatgaaacgctccggctctttcattgaaaagccattatcagaacgtgcg
atctcaacaataaaacactttttagagcacgctccgaatcaaaacgccagtgtctggcag
caagcactcggcggggcagccggacgggtcgctcccgaccaaacggcattttattatcgt
gacgcaatcatcgcccaggaatacttaacaaactggacatcccctggagaaaaaagacaa
aatgtccgctggattgaggggctgagaacgtccctttcgaaagaaacgatgggagactac
gtaaattggccagatatcgaaatcagaaactggccaagaacatattacggcgaaaacgtt
gaacgactccgccgtgtcaaaacgacatatgatccagaaaatgttttccgctttgaacag
agtattcctccgcttcgacgctctctgtttttctaa

DBGET integrated database retrieval system