KEGG   Bacillus subtilis subsp. subtilis 168: BSU08820
Entry
BSU08820          CDS       T00010                                 

Symbol
katA
Name
(RefSeq) vegetative catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00380  Tryptophan metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU08820 (katA)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BSU08820 (katA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BSU08820 (katA)
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 939240
NCBI-ProteinID: NP_388762
Pasteur: BG10849
BSORF: BG10849
UniProt: P26901 A0A3Q8S020
Position
complement(959535..960986)
AA seq 483 aa
MSSNKLTTSWGAPVGDNQNSMTAGSRGPTLIQDVHLLEKLAHFNRERVPERVVHAKGAGA
HGYFEVTNDVTKYTKAAFLSEVGKRTPLFIRFSTVAGELGSADTVRDPRGFAVKFYTEEG
NYDIVGNNTPVFFIRDAIKFPDFIHTQKRDPKTHLKNPTAVWDFWSLSPESLHQVTILMS
DRGIPATLRHMHGFGSHTFKWTNAEGEGVWIKYHFKTEQGVKNLDVNTAAKIAGENPDYH
TEDLFNAIENGDYPAWKLYVQIMPLEDANTYRFDPFDVTKVWSQKDYPLIEVGRMVLDRN
PENYFAEVEQATFSPGTLVPGIDVSPDKMLQGRLFAYHDAHRYRVGANHQALPINRARNK
VNNYQRDGQMRFDDNGGGSVYYEPNSFGGPKESPEDKQAAYPVQGIADSVSYDHYDHYTQ
AGDLYRLMSEDERTRLVENIVNAMKPVEKEEIKLRQIEHFYKADPEYGKRVAEGLGLPIK
KDS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagttcaaataaactgacaactagctggggcgctccggttggagataatcaaaactca
atgactgccggttctcgcggaccaactttaattcaagatgtacatttactcgaaaaattg
gcccatttcaaccgagaacgtgttcctgaacgtgttgttcacgccaaaggagcaggcgca
cacggatattttgaagtgacaaacgacgtaacaaaatacacgaaagccgctttcctttct
gaagtcggcaaacgcacaccgttgttcatccgtttctcaacagttgccggtgaacttggc
tctgctgacacagttcgcgacccgcgcggatttgctgttaaattttatactgaagaagga
aactacgacatcgtcggcaacaatacgcctgtattctttatccgcgatgcgattaagttc
cctgatttcatccatacacaaaaaagagatccaaaaacacacctgaaaaaccctacggct
gtatgggatttctggtcactttcaccagagtcactgcaccaagtgacaatcctgatgtct
gaccgcggaattcctgcgacacttcgccacatgcacggcttcggaagccatacattcaaa
tggacaaatgccgaaggcgaaggcgtatggattaaatatcactttaaaacagaacaaggc
gtgaaaaaccttgatgtcaatacggcagcaaaaattgccggtgaaaaccctgattaccat
acagaagaccttttcaacgcaatcgaaaacggtgattatcctgcatggaaactatatgtg
caaatcatgcctttagaagatgcaaatacgtaccgtttcgatccgtttgatgtcacaaaa
gtttggtctcaaaaagactacccgttaatcgaggtcggacgcatggttctagacagaaat
ccggaaaactactttgcagaggtagaacaagcgacattttcacctggaaccctcgtgcct
ggtattgatgtttcaccggataaaatgcttcaaggtcgactttttgcttatcatgatgca
caccgctaccgtgtcggtgcaaaccatcaagcgctgccaatcaaccgcgcacgcaacaaa
gtaaacaattatcagcgtgatgggcaaatgcgttttgatgataacggcggcggatctgtg
tattacgagcctaacagcttcggcggtccaaaagagtcacctgaggataagcaagcagca
tatccggtacaaggtatcgctgacagcgtaagctacgatcactacgatcactacactcaa
gccggcgatctgtatcgtttaatgagtgaagatgaacgtacccgccttgttgaaaatatc
gttaatgccatgaagccggtagaaaaagaagaaatcaagctgcgccaaatcgagcacttc
tacaaagcggatcctgaatacggaaaacgcgtggcagaaggccttggattgccgattaaa
aaagattcttaa

DBGET integrated database retrieval system