KEGG   Bacillus subtilis subsp. subtilis 168: BSU08830
Entry
BSU08830          CDS       T00010                                 

Symbol
ssuB
Name
(RefSeq) aliphatic sulfonates import ATP-binding protein SsuB
  KO
K15555  sulfonate transport system ATP-binding protein [EC:7.6.2.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU08830 (ssuB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU08830 (ssuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08830 (ssuB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.14  ABC-type aliphatic sulfonate transporter
     BSU08830 (ssuB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    BSU08830 (ssuB)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA AAA_22 Rad17 RsgA_GTPase AAA_16 bpMoxR AAA_29 NB-ARC Mg_chelatase AAA_33 NACHT ATPase_2 PduV-EutP AAA_18 AAA_15 AAA_5 ABC_ATPase AAA_25 AAA_30 AAA_28 RNA_helicase AAA_23
Other DBs
NCBI-GeneID: 939730
NCBI-ProteinID: NP_388763
Pasteur: BG12232
BSORF: BG12232
UniProt: P97027 A0A6M3Z8S7
Position
961394..962161
AA seq 255 aa
MAVTISIKEKAFVQEGRKNTVLENIELSIAPGEFLTLIGPSGCGKSTLLKIIAGLDSEYD
GSVEINGRSVTAPGIQQGFIFQEHRLFPWLTVEQNIAADLNLKDPKVKQKVDELIEIVRL
KGSEKAYPRELSGGMSQRVAIARALLREPEVLLLDEPFGALDAFTRKHLQDVLLDIWRKK
KTTMILVTHDIDESVYLGNELAILKAKPGKIHKLMPIHLAYPRNRTTPDFQAIRQRVLSE
FEKTEDLEYAEGSGI
NT seq 768 nt   +upstreamnt  +downstreamnt
gtggctgtgaccatcagcatcaaagaaaaggcatttgttcaagaaggccgcaaaaacacg
gtcttagaaaacatagaattatcaatcgcaccaggcgaatttctaacgcttatcggaccg
agcgggtgcggaaaaagcaccctgttaaagattattgcagggcttgattctgaatatgac
gggagtgtggaaattaacggccgcagcgtaacagctccgggtattcagcaaggatttatt
tttcaggaacaccgcctctttccttggctgactgttgagcagaatattgcagccgacttg
aatttgaaggacccaaaagtcaaacaaaaggtggatgaactgatcgagattgtcagattg
aaaggatcggaaaaagcatatccgcgcgagctgtcaggcggcatgtcacaaagagtagcc
atcgcccgggccctgctgcgggagcctgaggtgctgcttttagatgaaccgtttggtgca
ctcgacgcttttacaagaaaacacctgcaggacgtgctgctggatatatggaggaagaaa
aaaacaacgatgattctcgtgactcatgatatagatgaatctgtttatttaggaaatgag
cttgcgatccttaaggccaaaccggggaaaatccataagctgatgcccattcacctggcg
tatccgcgaaaccggacgactccggatttccaagcgatcagacagagagtgctgtcggaa
ttcgagaaaacagaagatttggagtacgcagaaggatcagggatatag

DBGET integrated database retrieval system