KEGG   Bacillus subtilis subsp. subtilis 168: BSU08850
Entry
BSU08850          CDS       T00010                                 

Symbol
ssuC
Name
(RefSeq) aliphatic sulfonates transport permease protein SsuC
  KO
K15554  sulfonate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU08850 (ssuC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU08850 (ssuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08850 (ssuC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    BSU08850 (ssuC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 936208
NCBI-ProteinID: NP_388765
Pasteur: BG10657
BSORF: BG10657
UniProt: P40401 A0A6M3ZC57
Position
963174..964004
AA seq 276 aa
MMKAEAAGSLPKTNAEAVRKKPGRKRYGWMKGLLLPAVIIAIWQVIGGLGVVSATVLPTP
VTIVLTFKELILSGELFGHLQISIYRAALGFLLGAGLGLMIGILAGFSKRTELYLDPSLQ
MLRTVPHLAVTPLFILWFGFDEVSKILLIALGAFFPVYINTFNGIRGVDAKLFEVARVLE
FKWHQQISKVILPAALPNILLGIRLSLGIAWLGLVVAELMGSSSGVGYMIMDARQFSQTN
KVFAGIIIFAVVGKLTDSFVRLLERKLLKWRNSYEG
NT seq 831 nt   +upstreamnt  +downstreamnt
atgatgaaagcagaggctgcgggctcgctgcccaaaacgaatgcggaagcggtgcgaaaa
aagcccggaaggaagagatacggctggatgaaggggcttttactgcccgctgtcatcatt
gccatctggcaggtcatcggcgggctgggggttgtgtccgctacagtgctgcctacacct
gttacgattgttctgacctttaaggagcttattttgtccggcgaactgttcggccatctg
caaatcagcatttatcgggcggcacttggttttttgcttggcgcggggcttggattgatg
atcgggattttggccggattttccaaacggacggagctgtatcttgatccgtcgttgcaa
atgcttagaaccgtacctcatctggccgtcacgccgctgtttattttatggttcggattt
gacgaagtatctaaaattttgctgattgcgctcggtgccttctttcctgtctatatcaat
acgtttaacggcatccgcggggttgacgcgaagctgtttgaagtcgcccgggtgcttgaa
tttaaatggcatcagcagatatccaaagtgatattgccggcagccctgcccaatatattg
ctaggcattcgcttatcgctcggcattgcatggctcgggctcgttgtggcagagctgatg
ggctcaagctcgggagtcggctatatgatcatggatgcgagacagttttcacaaacgaat
aaagtctttgcagggattatcatttttgcagtggttggaaagctgacggattccttcgtc
aggctgcttgaacgaaagctgttaaagtggagaaacagctacgaaggataa

DBGET integrated database retrieval system