KEGG   Bacillus subtilis subsp. subtilis 168: BSU08860
Entry
BSU08860          CDS       T00010                                 

Symbol
ssuD
Name
(RefSeq) alkanesulfonate monooxygenase
  KO
K04091  alkanesulfonate monooxygenase [EC:1.14.14.5 1.14.14.34]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU08860 (ssuD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.5  alkanesulfonate monooxygenase
     BSU08860 (ssuD)
    1.14.14.34  methanesulfonate monooxygenase (FMNH2)
     BSU08860 (ssuD)
SSDB
Motif
Pfam: Bac_luciferase ATP-synt_DE TMEM171
Other DBs
NCBI-GeneID: 939733
NCBI-ProteinID: NP_388766
Pasteur: BG10658
BSORF: BG10658
UniProt: P40402 A0A6M4JGP3
Position
964027..965157
AA seq 376 aa
MEILWFIPTHGDARYLGSESDGRTADHLYFKQVAQAADRLGYTGVLLPTGRSCEDPWLTA
SALAGETKDLKFLVAVRPGLMQPSLAARMTSTLDRISDGRLLINVVAGGDPYELAGDGLF
ISHDERYEATDEFLTVWRRLLQGETVSYEGKHIKVENSNLLFPPQQEPHPPIYFGGSSQA
GIEAAAKHTDVYLTWGEPPEQVKEKIERVKKQAAKEGRSVRFGIRLHVIARETEQEAWEA
AERLISHLDDDTIAKAQAALSRYDSSGQQRMAVLHQGDRTKLEISPNLWAGIGLVRGGAG
TALVGDPQTIADRIAEYQALGIESFIFSGYPHLEEAYYFAELVFPLLPFENDRTRKLQNK
RGEAVGNTYFVKEKNA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggaaattctttggtttataccgactcatggagacgcgagatatttaggatctgaaagt
gatggacggactgcggatcatctttactttaaacaagtcgcgcaggcggcagacaggctg
ggatatacaggagttcttctgccaacgggaagatcgtgcgaggacccgtggcttacagcg
tcggcactggcaggagaaacaaaggacttaaagtttttagtcgcggtaagacctggttta
atgcagccttctctggcagccagaatgacatccaccctagaccgcatttcagacggccgg
ctgctgatcaacgttgtggcagggggcgatccgtatgagctggcaggcgatggcctgttt
atcagccatgatgagcgctacgaggcaacagacgaatttttaaccgtttggcggagactt
ttgcagggagaaacggtttcctatgaaggaaagcatataaaagtggaaaacagcaatctg
cttttcccgccgcagcaagagccgcatccgcccatctatttcggtggttcgtcacaggct
ggaattgaagctgccgcaaagcatacagacgtgtacttgacatggggtgagccgcctgaa
caagtaaaagaaaagatagaaagagtcaaaaagcaagcggcaaaagaagggagatccgtt
cgatttggcattaggctgcatgtcattgcccgtgaaactgaacaagaggcatgggaagcg
gcagagcgcttgatcagccacttggatgatgacaccattgccaaagcgcaggcagctttg
agccgttacgactcttcaggccagcagcggatggccgtccttcatcaaggcgatcggacg
aagcttgaaatcagcccgaatctgtgggcggggatcggcctggtcagaggaggggcagga
acagctcttgtcggtgatccgcagacgattgccgaccggatagcggagtaccaggcactc
ggcatagaatcgtttatattctccggctatccgcatttagaagaagcgtattattttgca
gagcttgtatttccgcttttgccgtttgaaaatgatcggacgagaaagcttcagaacaaa
aggggagaagcggtaggaaacacttattttgtcaaagagaaaaatgcatga

DBGET integrated database retrieval system