KEGG   Bacillus subtilis subsp. subtilis 168: BSU08870Help
Entry
BSU08870          CDS       T00010                                 

Gene name
ygaN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939249
NCBI-ProteinID: NP_388767
Pasteur: BG12233
BSORF: BG12233
UniProt: P97028
Position
965261..965797
Genome map
AA seq 178 aa AA seqDB search
MLSACGHSKQMEIKAADISDLEKNRMDVAASQAFTAEAVNIGEGISSADMYIEHYQKGKL
VERFGPVRADYSEEKTDTIQFVYFENEEGEGKNKHTTIHFGIVDKQGTIAADSSVKRDDS
TTQEMTQNISSPEPITFEKPALIGSSIRGTDETMHTSEHKKELIKHQDALLYYVELHH
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcagcatgcggacattcaaaacagatggaaatcaaagcggcggacatatcagat
cttgaaaaaaacagaatggatgtcgcagcttcacaggcattcactgccgaagccgtcaat
atcggtgaaggtatttcttcagctgacatgtacatcgaacattatcaaaagggaaagctt
gttgagaggtttggaccggttcgtgcagattattcagaggaaaaaactgataccatacaa
tttgtttattttgagaatgaagagggggaaggaaagaataaacataccaccattcatttt
ggcattgtggataaacagggaactatagcggctgattcatcggtgaaacgcgacgatagc
acaacacaggaaatgactcagaatatttcatcgccggaaccgattactttcgagaagcct
gctttgatcggcagcagtattagagggactgacgagacaatgcacacctctgaacataaa
aaagagctcattaagcatcaagatgcgttactgtattatgtggaattgcatcattag

DBGET integrated database retrieval system