KEGG   Bacillus subtilis subsp. subtilis 168: BSU08880Help
Entry
BSU08880          CDS       T00010                                 

Gene name
rpsN
Definition
(RefSeq) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU08880 (rpsN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU08880 (rpsN)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU08880 (rpsN)
  Bacteria
    BSU08880 (rpsN)
  Archaea
    BSU08880 (rpsN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S14 DUF3073
Motif
Other DBs
NCBI-GeneID: 936213
NCBI-ProteinID: NP_388768
Pasteur: BG13085
BSORF: BG13085
UniProt: O31587
Position
965909..966178
Genome map
AA seq 89 aa AA seqDB search
MAKKSKVAKELKRQQLVEQYAGIRRELKEKGDYEALSKLPRDSAPGRLHNRCMVTGRPRA
YMRKFKMSRIAFRELAHKGQIPGVKKASW
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaaatcaaaagtggcaaaagagttaaaacgccaacagcttgttgagcaatac
gctggtattagacgcgagttgaaggaaaaaggagattacgaggcactcagcaagctgcca
agagattcagcaccgggaaggcttcacaaccgctgcatggtaacggggcgcccgagagca
tatatgaggaagtttaaaatgtccagaatcgctttcagggagctggcccataaaggccag
attcccggtgtgaaaaaagcaagctggtaa

DBGET integrated database retrieval system