KEGG   Bacillus subtilis subsp. subtilis 168: BSU08890
Entry
BSU08890          CDS       T00010                                 

Symbol
ygaO
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3169 DUF3784 DUF6442 MSP1a SbcC_Walker_B DUF6773
Other DBs
NCBI-GeneID: 939244
NCBI-ProteinID: NP_388769
Pasteur: BG12234
BSORF: BG12234
UniProt: P97029 A0A6M3Z9A6
Position
complement(966196..966669)
AA seq 157 aa
MSMKTKAAFHLVLFGLACWALISYFEASEGIASFFGTKSGGMVFDLNLTPFILFVAASAV
YLYLQKKSRPARKQLLLPDEFEEQDEREQMMTAKACRASYIAVYFSLPAAAVLLIFYPLF
QSRIPFFPIIIVFIIMIIQHLSYVISFKKNEKNSGAL
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagcatgaaaacaaaagcagcttttcaccttgttttatttggccttgcatgctgggcg
ctgatttcatactttgaagcctcagaaggcatagcatcttttttcggcacaaagagcggc
gggatggtatttgatttaaacctcactccctttattctgtttgttgcggcgtctgcggtt
tatttgtacttacagaaaaaaagccgccctgccagaaagcagctacttctgcctgatgag
tttgaagagcaggatgaaagagagcagatgatgacggcaaaagcatgtcgcgcgtcatat
atcgctgtctacttctcgctgcctgccgcagcggttcttctcattttttatccgctattt
caatcgcgcattccgtttttccctattattattgtgtttatcatcatgatcatccagcac
ctttcctacgtcatctctttcaagaaaaacgaaaaaaactccggcgcgctgtaa

DBGET integrated database retrieval system