KEGG   Bacillus subtilis subsp. subtilis 168: BSU08900
Entry
BSU08900          CDS       T00010                                 

Symbol
yhzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: B3_4
Other DBs
NCBI-GeneID: 939736
NCBI-ProteinID: NP_388771
Pasteur: BG13086
BSORF: BG13086
UniProt: O31588 A0A6M4JEK0
Position
complement(967229..967852)
AA seq 207 aa
MNIKLDSVITERAAGLHAAAVIYENIEVGSSPQMLKGRLRLFQESLFFDYADGGISDESF
VKEWQKLFKQLNPSFEGETTPMEDMLVPISKEQFMESKDSAHDTIDFFALKYSLPIMIYD
AGKLHEPVRISLGEKENILLFSDENGIFGDFKNSVNHYPVSNETKNMLQIIFFPPSIEKS
SAVNLLSSLTKMFEQIHGGTHTVHWLT
NT seq 624 nt   +upstreamnt  +downstreamnt
gtgaatatcaaacttgattctgttattactgaacgtgcggccggcttacatgcagctgct
gtcatttatgagaatatcgaagtcggctcctcaccgcaaatgctgaaaggcagactccgc
ctgtttcaagaatccttgtttttcgactatgcggacggcggtatatccgatgaatccttc
gtcaaggaatggcagaaactctttaaacagcttaacccttcatttgagggagaaacaacc
ccaatggaggacatgctggtcccgatatccaaggaacaattcatggaaagtaaagactcg
gcccatgacacaatcgattttttcgcattaaaatattctctgcctattatgatttatgat
gccggaaagcttcatgagccggtccggatctcattgggagaaaaagaaaacatactgctt
ttctctgatgaaaacggcatttttggcgatttcaaaaacagcgtcaaccactatcccgtt
tcaaacgagactaagaatatgctgcaaatcatttttttcccgccatcgattgagaaaagc
agcgctgttaacctcttatcatcattaacgaaaatgtttgaacaaattcacggcggcacc
catacagtacattggcttacgtaa

DBGET integrated database retrieval system