KEGG   Bacillus subtilis subsp. subtilis 168: BSU08910
Entry
BSU08910          CDS       T00010                                 

Symbol
yhbA
Name
(RefSeq) epoxyqueuosine reductase
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU08910 (yhbA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     BSU08910 (yhbA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU08910 (yhbA)
SSDB
Motif
Pfam: DUF1730 Fer4_16 HEAT_2 HEAT_PBS Fer4_10 Fer4 Fer4_6 Fer4_9 Fer4_7 Fer4_2 HEAT_EZ HEAT Fer4_21 Fer4_3 DNA_alkylation RICTOR_V
Other DBs
NCBI-GeneID: 939243
NCBI-ProteinID: NP_388772
Pasteur: BG12236
BSORF: BG12236
UniProt: P97030 A0A6M3Z8U0
Structure
PDB: 
5D08 5D0A 5T8Y 5D0B

Position
967935..969095
AA seq 386 aa
MNVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTP
KLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFL
KSKHEDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEP
DVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGC
DTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPI
QRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEK
DEEAKLEIEKGIELLKASGMTKQGLS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacgtttatcagctcaaagaagaattaattgaatacgcgaaaagcattggcgtagac
aagattggttttacgaccgctgatacttttgacagtttaaaagaccgtttgattcttcaa
gaatcactcggctatctctccggctttgaagagccagatatcgaaaaaagggtgacgccg
aagcttcttttgccgaaagcgaaatcaatagtggcaattgctctcgcatatccttccaga
atgaaggatgcgccgagaagcacgagaactgagcgcaggggcattttttgcagagcttcc
tggggaaaagactatcatgatgtgctgagggaaaagcttgatctgctggaggattttcta
aaaagcaagcatgaggatatcagaacgaagtcaatggttgatacaggtgaattgtctgat
cgcgccgttgcggaacgtgccggaatcggattcagtgcgaaaaactgtatgatcacaaca
cccgagtatggctcttatgtgtatttggcggaaatgatcacaaatatcccttttgagcct
gatgtgccgattgaagatatgtgcgggtcctgcacgaaatgcttggacgcctgcccaacg
ggagcactggttaatcccgggcagcttaatgcgcagcgctgcatctcttttctgacccag
acaaaaggatttttgcctgatgaattccggacaaaaatcggaaaccgcctgtacgggtgc
gatacgtgccaaacggtatgccctctcaataaagggaaggattttcatcttcatccggaa
atggagcctgatcctgagattgccaaaccgttattgaagccgcttttggccatcagcaat
cgggaatttaaggagaaattcgggcatgtctcaggttcttggcgcggaaaaaaaccgatt
cagcgaaacgccattctcgcgcttgcccattttaaggatgcttccgcactgcctgaattg
acggaactgatgcacaaggatccgcgtcctgtcatcagggggacagccgcatgggcaatc
ggaaaaatcggagaccccgcctacgcggaagagcttgaaaaagcgctggaaaaagagaag
gatgaagaggcaaagctggaaattgaaaaaggaattgagttgctaaaagcttcaggcatg
actaaacaaggcctgtcctga

DBGET integrated database retrieval system