KEGG   Bacillus subtilis subsp. subtilis 168: BSU08920
Entry
BSU08920          CDS       T00010                                 

Symbol
yhbB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Amidase_6 CHAP
Other DBs
NCBI-GeneID: 936223
NCBI-ProteinID: NP_388773
Pasteur: BG11811
BSORF: BG11811
UniProt: O31589 A0A6M3Z8Q5
Position
969162..970097
AA seq 311 aa
MAGGVSLKYILEQLAEERLGFLVNGHAMRQESQVGDLKVMERKKKLLEKRKVDIIKAKAK
AVINHVRVEDDGTTCLSYTIHYEYVCKEQDDSLYIEEHIEERMAFLYDHILISDQEIAKK
PAGFHEGTSIIDYSEAEEEREAFGRAFQYDRLGAVQYAEKFWNKRNPAYKNFSDNCTNFI
SQCLHAGGAPMRGHPNRGSGWWMKQSSWSYSWTVAHSMKMYLSNSKAGLRAVRVKSAEEL
MPGDVICYDFEGDGRFNHTTIVVAKDKGNMPLVNAQTYDSRMRYWSYEDSTAYTPSIRYA
FFHIVDDTTKE
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgggtggggtgagcttgaagtacattttagaacaattagcggaggagcggctgggc
tttctggttaacgggcatgctatgagacaggagtctcaagtcggagaccttaaagtcatg
gagcgtaagaaaaagcttctggaaaaacgtaaagttgacatcataaaagcgaaagcaaag
gccgtgattaatcatgtgcgggttgaggatgacggaacgacctgcctttcgtataccatc
cattacgaatacgtgtgtaaggaacaagatgacagcttgtatatagaagagcacatagag
gagcgaatggctttcctgtatgatcacattttgattagtgatcaggaaattgcgaaaaag
ccggctggatttcatgaagggaccagtattattgactattctgaagctgaagaggaaaga
gaagcgtttggcagggcttttcaatacgatcgtctcggcgctgtccaatatgccgagaaa
ttttggaacaagcgcaatcctgcttataaaaatttcagcgataactgtacaaattttatt
tctcagtgtcttcatgcaggaggcgcgccgatgcgcggtcatccgaacaggggatcaggc
tggtggatgaaacaaagctcatggagctacagctggacggtggctcactctatgaaaatg
tatttgtcgaattcaaaggccggactgcgtgcggtgcgggtgaaatcagcggaagaactg
atgccgggcgatgtgatttgctatgacttcgaaggagacggccggtttaatcatacaacg
attgtcgtggcaaaggacaaaggcaatatgccgcttgtcaacgcccagacttatgacagc
aggatgaggtattggtcatatgaggattctacggcatacacgccgtcaatacgatatgcc
ttttttcatatcgttgatgatacgacaaaagagtaa

DBGET integrated database retrieval system