KEGG   Bacillus subtilis subsp. subtilis 168: BSU08930
Entry
BSU08930          CDS       T00010                                 

Symbol
cspR
Name
(RefSeq) tRNA (cytidine(34)-2'-O)-methyltransferase
  KO
K03216  tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU08930 (cspR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     BSU08930 (cspR)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    BSU08930 (cspR)
SSDB
Motif
Pfam: SpoU_methylase
Other DBs
NCBI-GeneID: 939735
NCBI-ProteinID: NP_388774
Pasteur: BG11802
BSORF: BG11802
UniProt: O31590 A0A6M3Z8T6
Position
970135..970617
AA seq 160 aa
MNIVALHVVLYQPEIPANTGNIARTCAATNTTLHLIRPLGFSTDDKMLKRAGLDYWEFVN
VVYHDSLEELFEAYKKGKFFFITKFGQQPHTSFDYTDLDEDYFFVFGRETSGLPKDLIQN
NMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDLK
NT seq 483 nt   +upstreamnt  +downstreamnt
gtgaacattgtggcattacatgtcgttttatatcaaccagaaattcccgctaacacaggg
aatattgcacgtacttgtgcagcaaccaatacaacgctacacctgattcgtccgctcggc
ttttcaacggatgataaaatgctgaagcgtgccggactcgattattgggagtttgttaac
gttgtgtatcatgattcgttagaagaattgtttgaggcatataaaaaaggcaagtttttc
tttattacaaaatttggccagcagcctcatacatcatttgattacactgatcttgacgag
gattatttcttcgtgttcggaagagaaacaagcggtttgccaaaggatttaattcaaaat
aatatggaccgctgcctgcgtcttccgatgacagagcatgtcagatcgttaaatctgtcc
aatactgccgcgattcttgtttatgaagcgctgcgccagcaaaattaccgtgatttaaaa
tag

DBGET integrated database retrieval system